WordPress database error: [Table 'rss.rss_posts' doesn't exist]
SELECT id, guid, post_modified_gmt FROM rss_posts WHERE guid='http://www.epikone.com/blog/?p=917'

WordPress database error: [Table 'rss.rss_posts' doesn't exist]
SELECT post_name FROM rss_posts WHERE post_name = 'google-analytics-training-in-montreal' AND post_type = 'post' AND ID != '' AND post_parent = '0' LIMIT 1

WordPress database error: [Table 'rss.rss_posts' doesn't exist]
INSERT IGNORE INTO rss_posts (post_author, post_date, post_date_gmt, post_content, post_content_filtered, post_title, post_excerpt, post_status, post_type, comment_status, ping_status, post_password, post_name, to_ping, pinged, post_modified, post_modified_gmt, post_parent, menu_order, post_mime_type) VALUES ('232', '2008-11-21 01:58:04', '2008-11-20 17:58:04', '<p> <img hspace=\"7\" src=\"http://www.epikone.com/blog/wp-content/uploads/2008/11/pastedgraphic.tiff\" alt=\"\" /><br /> Do you live in Montreal or on the East Coast of the US? Want to learn more about how to find actionable data in <a href=\"http://analytics.google.com\">Google Analytics</a>? Then join us for <a href=\"http://www.epikone.com/services/training/seminars/\">Google Analytics Seminars for Success in Montreal on December 8 and 9</a>.</p> <p>We&#8217;ve been putting on these training events for almost a year now, and, to be honest, I think they are an amazing value. The cost is $249 US per day and our goal is to dump everything we know into your brain. Seriously.</p> <p>Day 1 focuses on the data in GA and how to find actionable information. We cover almost every report and the insights you can draw from each. Also during day 1 we&#8217;ll cover many of the new GA analysis tools including Advanced Segmentation, Custom Reports and Motion Charts. Here&#8217;s a taste of day 1 topics:</p> <ul> <li>Introduction to Web Analytics</li> <li>Website testing with the Google Website Optimizer</li> <li>Google Analytics Reporting Features</li> <li>Sharing GA Data</li> <li>Custom Dashboards</li> <li>Understanding Site Visitors</li> <li>Tracking online marketing campaigns</li> <li>Evaluating site content and user navigation</li> <li>Understanding Goals and Conversion Funnels</li> </ul> <p>On day 2 we really dig into how GA works and how to get it configured correctly. Ever wonder how all that great day gets into GA? We cover that in the morning. Have you been curious about how to use filters and profiles? Yup, we cover that too. We even cover event tracking in the hopes that it will be released from beta soon! :) Treats for day 2 include:</p> <ul> <li>GA architecture overview</li> <li>Learning about Regular Expressions</li> <li>Improving your data with filters</li> <li>Setting up Goals and Funnels</li> <li>Implementing E-Commerce Tracking</li> <li>Configuring Custom Segmentation</li> <li>Introduction to Event Tracking</li> <li>Tracking websites with multiple domains/subdomains</li> <li>Code customization</li> </ul> <p>But I think the best part of Seminars for Success is the interaction. We usually have groups of 60 which is big, but we&#8217;re able to have lively discussions about data and its uses.</p> <p>You can learn more and sign up for Seminars for Success <a href=\"http://www.epikone.com/services/training/seminars/\">here</a>. Got questions? Leave a comment below.</p> <p>And don&#8217;t worry if you can&#8217;t make it to Montreal, we&#8217;ll be doing more of these next year in different cities around the US and hopefully Canada.</p> <div> <a href=\"http://feeds.feedburner.com/~f/AnalyticsTalk?a=fkp1n\"><img src=\"http://feeds.feedburner.com/~f/AnalyticsTalk?i=fkp1n\" border=\"0\"></img></a> <a href=\"http://feeds.feedburner.com/~f/AnalyticsTalk?a=VDc8n\"><img src=\"http://feeds.feedburner.com/~f/AnalyticsTalk?i=VDc8n\" border=\"0\"></img></a> <a href=\"http://feeds.feedburner.com/~f/AnalyticsTalk?a=91lln\"><img src=\"http://feeds.feedburner.com/~f/AnalyticsTalk?i=91lln\" border=\"0\"></img></a> <a href=\"http://feeds.feedburner.com/~f/AnalyticsTalk?a=VQV4n\"><img src=\"http://feeds.feedburner.com/~f/AnalyticsTalk?i=VQV4n\" border=\"0\"></img></a> </div><img src=\"http://feeds.feedburner.com/~r/AnalyticsTalk/~4/459827347\" height=\"1\">', '', 'Google Analytics Training in Montreal', ' Do you live in Montreal or on the East Coast of the US? Want to learn more about how to find actionable data in Google Analytics? Then join us for Google Analytics Seminars for Success in Montreal on December 8 and 9. We&#8217;ve been putting on these training events for almost a year [...]', 'publish', 'post', 'closed', 'closed', '', 'google-analytics-training-in-montreal', '', '', '2008-11-21 01:58:04', '2008-11-20 17:58:04', '0', '0', '')

WordPress database error: [Table 'rss.rss_posts' doesn't exist]
SELECT COUNT(*) FROM rss_term_relationships, rss_posts WHERE rss_posts.ID = rss_term_relationships.object_id AND post_status = 'publish' AND post_type = 'post' AND term_taxonomy_id = '1'

WordPress database error: [Table 'rss.rss_posts' doesn't exist]
UPDATE rss_posts SET guid = '' WHERE ID = '0'

WordPress database error: [Table 'rss.rss_posts' doesn't exist]
UPDATE rss_posts SET guid = '' WHERE ID = ''

There may be a bug in FeedWordPress. Please contact the author and paste the following information into your e-mail:

Triggered at line # 2152 FeedWordPress version: 0.991 WordPress version: 2.3.1 PHP version: 5.2.6 SyndicatedPost (_wp_id problem): object(SyndicatedPost)#88 (9) { ["item"]=> array(13) { ["title"]=> string(37) "Google Analytics Training in Montreal" ["link"]=> string(58) "http://feeds.feedburner.com/~r/AnalyticsTalk/~3/459827347/" ["comments"]=> string(86) "http://www.epikone.com/blog/2008/11/20/google-analytics-training-in-montreal/#comments" ["pubdate"]=> string(31) "Thu, 20 Nov 2008 17:58:04 +0000" ["dc"]=> array(1) { ["creator"]=> string(14) "Justin Cutroni" } ["category"]=> string(13) "Uncategorized" ["guid"]=> string(34) "http://www.epikone.com/blog/?p=917" ["description"]=> string(295) " Do you live in Montreal or on the East Coast of the US? Want to learn more about how to find actionable data in Google Analytics? Then join us for Google Analytics Seminars for Success in Montreal on December 8 and 9. We&#8217;ve been putting on these training events for almost a year [...]" ["content"]=> array(1) { ["encoded"]=> string(3497) "<p> <img style="border:none;" hspace="7" src="http://www.epikone.com/blog/wp-content/uploads/2008/11/pastedgraphic.tiff" alt="" title="GA Seminar Leader" class="alignright size-full wp-image-921" /><br /> Do you live in Montreal or on the East Coast of the US? Want to learn more about how to find actionable data in <a href="http://analytics.google.com">Google Analytics</a>? Then join us for <a href="http://www.epikone.com/services/training/seminars/">Google Analytics Seminars for Success in Montreal on December 8 and 9</a>.</p> <p>We&#8217;ve been putting on these training events for almost a year now, and, to be honest, I think they are an amazing value. The cost is $249 US per day and our goal is to dump everything we know into your brain. Seriously.</p> <p>Day 1 focuses on the data in GA and how to find actionable information. We cover almost every report and the insights you can draw from each. Also during day 1 we&#8217;ll cover many of the new GA analysis tools including Advanced Segmentation, Custom Reports and Motion Charts. Here&#8217;s a taste of day 1 topics:</p> <ul> <li>Introduction to Web Analytics</li> <li>Website testing with the Google Website Optimizer</li> <li>Google Analytics Reporting Features</li> <li>Sharing GA Data</li> <li>Custom Dashboards</li> <li>Understanding Site Visitors</li> <li>Tracking online marketing campaigns</li> <li>Evaluating site content and user navigation</li> <li>Understanding Goals and Conversion Funnels</li> </ul> <p>On day 2 we really dig into how GA works and how to get it configured correctly. Ever wonder how all that great day gets into GA? We cover that in the morning. Have you been curious about how to use filters and profiles? Yup, we cover that too. We even cover event tracking in the hopes that it will be released from beta soon! :) Treats for day 2 include:</p> <ul> <li>GA architecture overview</li> <li>Learning about Regular Expressions</li> <li>Improving your data with filters</li> <li>Setting up Goals and Funnels</li> <li>Implementing E-Commerce Tracking</li> <li>Configuring Custom Segmentation</li> <li>Introduction to Event Tracking</li> <li>Tracking websites with multiple domains/subdomains</li> <li>Code customization</li> </ul> <p>But I think the best part of Seminars for Success is the interaction. We usually have groups of 60 which is big, but we&#8217;re able to have lively discussions about data and its uses.</p> <p>You can learn more and sign up for Seminars for Success <a href="http://www.epikone.com/services/training/seminars/">here</a>. Got questions? Leave a comment below.</p> <p>And don&#8217;t worry if you can&#8217;t make it to Montreal, we&#8217;ll be doing more of these next year in different cities around the US and hopefully Canada.</p> <div class="feedflare"> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=fkp1n"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=fkp1n" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=VDc8n"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=VDc8n" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=91lln"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=91lln" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=VQV4n"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=VQV4n" border="0"></img></a> </div><img src="http://feeds.feedburner.com/~r/AnalyticsTalk/~4/459827347" height="1" width="1"/>" } ["wfw"]=> array(1) { ["commentrss"]=> string(82) "http://www.epikone.com/blog/2008/11/20/google-analytics-training-in-montreal/feed/" } ["feedburner"]=> array(2) { ["awareness"]=> string(173) "http://api.feedburner.com/awareness/1.0/GetItemData?uri=AnalyticsTalk&itemurl=http%3A%2F%2Fwww.epikone.com%2Fblog%2F2008%2F11%2F20%2Fgoogle-analytics-training-in-montreal%2F" ["origlink"]=> string(77) "http://www.epikone.com/blog/2008/11/20/google-analytics-training-in-montreal/" } ["summary"]=> string(295) " Do you live in Montreal or on the East Coast of the US? Want to learn more about how to find actionable data in Google Analytics? Then join us for Google Analytics Seminars for Success in Montreal on December 8 and 9. We&#8217;ve been putting on these training events for almost a year [...]" ["atom_content"]=> string(3497) "<p> <img style="border:none;" hspace="7" src="http://www.epikone.com/blog/wp-content/uploads/2008/11/pastedgraphic.tiff" alt="" title="GA Seminar Leader" class="alignright size-full wp-image-921" /><br /> Do you live in Montreal or on the East Coast of the US? Want to learn more about how to find actionable data in <a href="http://analytics.google.com">Google Analytics</a>? Then join us for <a href="http://www.epikone.com/services/training/seminars/">Google Analytics Seminars for Success in Montreal on December 8 and 9</a>.</p> <p>We&#8217;ve been putting on these training events for almost a year now, and, to be honest, I think they are an amazing value. The cost is $249 US per day and our goal is to dump everything we know into your brain. Seriously.</p> <p>Day 1 focuses on the data in GA and how to find actionable information. We cover almost every report and the insights you can draw from each. Also during day 1 we&#8217;ll cover many of the new GA analysis tools including Advanced Segmentation, Custom Reports and Motion Charts. Here&#8217;s a taste of day 1 topics:</p> <ul> <li>Introduction to Web Analytics</li> <li>Website testing with the Google Website Optimizer</li> <li>Google Analytics Reporting Features</li> <li>Sharing GA Data</li> <li>Custom Dashboards</li> <li>Understanding Site Visitors</li> <li>Tracking online marketing campaigns</li> <li>Evaluating site content and user navigation</li> <li>Understanding Goals and Conversion Funnels</li> </ul> <p>On day 2 we really dig into how GA works and how to get it configured correctly. Ever wonder how all that great day gets into GA? We cover that in the morning. Have you been curious about how to use filters and profiles? Yup, we cover that too. We even cover event tracking in the hopes that it will be released from beta soon! :) Treats for day 2 include:</p> <ul> <li>GA architecture overview</li> <li>Learning about Regular Expressions</li> <li>Improving your data with filters</li> <li>Setting up Goals and Funnels</li> <li>Implementing E-Commerce Tracking</li> <li>Configuring Custom Segmentation</li> <li>Introduction to Event Tracking</li> <li>Tracking websites with multiple domains/subdomains</li> <li>Code customization</li> </ul> <p>But I think the best part of Seminars for Success is the interaction. We usually have groups of 60 which is big, but we&#8217;re able to have lively discussions about data and its uses.</p> <p>You can learn more and sign up for Seminars for Success <a href="http://www.epikone.com/services/training/seminars/">here</a>. Got questions? Leave a comment below.</p> <p>And don&#8217;t worry if you can&#8217;t make it to Montreal, we&#8217;ll be doing more of these next year in different cities around the US and hopefully Canada.</p> <div class="feedflare"> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=fkp1n"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=fkp1n" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=VDc8n"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=VDc8n" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=91lln"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=91lln" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=VQV4n"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=VQV4n" border="0"></img></a> </div><img src="http://feeds.feedburner.com/~r/AnalyticsTalk/~4/459827347" height="1" width="1"/>" } ["link"]=> object(SyndicatedLink)#147 (4) { ["id"]=> string(2) "51" ["link"]=> object(stdClass)#83 (22) { ["link_id"]=> string(2) "51" ["link_url"]=> string(27) "http://www.epikone.com/blog" ["link_name"]=> string(14) "Analytics Talk" ["link_image"]=> string(0) "" ["link_target"]=> string(0) "" ["link_category"]=> string(1) "0" ["link_description"]=> string(0) "" ["link_visible"]=> string(1) "Y" ["link_owner"]=> string(1) "1" ["link_rating"]=> string(1) "0" ["link_updated"]=> string(19) "0000-00-00 00:00:00" ["link_rel"]=> string(0) "" ["link_notes"]=> string(1398) "feed/title#: 1 feed/title: Analytics Talk feed/link#: 1 feed/link: http://www.epikone.com/blog feed/description#: 1 feed/pubdate#: 1 feed/pubdate: Thu, 20 Nov 2008 17:58:04 +0000 feed/generator#: 1 feed/generator: http://wordpress.org/?v=2.6.1 feed/language#: 1 feed/language: en feed/atom/link#: 1 feed/atom/link@: xmlns:atom10,rel,href,type feed/atom/link@xmlns:atom10: http://www.w3.org/2005/Atom feed/atom/link@rel: self feed/atom/link@href: http://feeds.feedburner.com/AnalyticsTalk feed/atom/link@type: application/rss+xml feed/http://rssnamespace.org/feedburner/ext/1.0/emailserviceid#: 1 feed/http://rssnamespace.org/feedburner/ext/1.0/emailserviceid: 564583 feed/http://rssnamespace.org/feedburner/ext/1.0/feedburnerhostname#: 1 feed/http://rssnamespace.org/feedburner/ext/1.0/feedburnerhostname: http://www.feedburner.com feed/http://rssnamespace.org/feedburner/ext/1.0/awareness#: 1 feed/http://rssnamespace.org/feedburner/ext/1.0/awareness: http://api.feedburner.com/awareness/1.0/GetFeedData?uri=AnalyticsTalk feed/tagline#: 1 feed/subtitle#: 1 feed/id: http://feeds.feedburner.com/AnalyticsTalk update/last: 1228180686 update/ttl: 114 update/timed: automatically update/hold: scheduled feed/feedburner/emailserviceid: 564583 feed/feedburner/feedburnerhostname: http://www.feedburner.com feed/feedburner/awareness: http://api.feedburner.com/awareness/1.0/GetFeedData?uri=AnalyticsTalk " ["link_rss"]=> string(41) "http://feeds.feedburner.com/AnalyticsTalk" ["object_id"]=> string(2) "51" ["term_taxonomy_id"]=> string(1) "2" ["term_id"]=> string(1) "2" ["taxonomy"]=> string(13) "link_category" ["description"]=> string(0) "" ["parent"]=> string(1) "0" ["count"]=> string(2) "44" ["recently_updated"]=> string(1) "0" } ["settings"]=> array(36) { ["feed/title#"]=> string(1) "1" ["feed/title"]=> string(14) "Analytics Talk" ["feed/link#"]=> string(1) "1" ["feed/link"]=> string(27) "http://www.epikone.com/blog" ["feed/description#"]=> string(1) "1" ["feed/pubdate#"]=> string(1) "1" ["feed/pubdate"]=> string(31) "Thu, 20 Nov 2008 17:58:04 +0000" ["feed/generator#"]=> string(1) "1" ["feed/generator"]=> string(29) "http://wordpress.org/?v=2.6.1" ["feed/language#"]=> string(1) "1" ["feed/language"]=> string(2) "en" ["feed/atom/link#"]=> string(1) "1" ["feed/atom/link@"]=> string(26) "xmlns:atom10,rel,href,type" ["feed/atom/link@xmlns:atom10"]=> string(27) "http://www.w3.org/2005/Atom" ["feed/atom/link@rel"]=> string(4) "self" ["feed/atom/link@href"]=> string(41) "http://feeds.feedburner.com/AnalyticsTalk" ["feed/atom/link@type"]=> string(19) "application/rss+xml" ["feed/http://rssnamespace.org/feedburner/ext/1.0/emailserviceid#"]=> string(1) "1" ["feed/http://rssnamespace.org/feedburner/ext/1.0/emailserviceid"]=> string(6) "564583" ["feed/http://rssnamespace.org/feedburner/ext/1.0/feedburnerhostname#"]=> string(1) "1" ["feed/http://rssnamespace.org/feedburner/ext/1.0/feedburnerhostname"]=> string(25) "http://www.feedburner.com" ["feed/http://rssnamespace.org/feedburner/ext/1.0/awareness#"]=> string(1) "1" ["feed/http://rssnamespace.org/feedburner/ext/1.0/awareness"]=> string(69) "http://api.feedburner.com/awareness/1.0/GetFeedData?uri=AnalyticsTalk" ["feed/tagline#"]=> string(1) "1" ["feed/subtitle#"]=> string(1) "1" ["feed/id"]=> string(41) "http://feeds.feedburner.com/AnalyticsTalk" ["update/last"]=> int(1228187865) ["update/ttl"]=> int(62) ["update/timed"]=> string(13) "automatically" ["update/hold"]=> string(9) "scheduled" ["feed/feedburner/emailserviceid"]=> string(6) "564583" ["feed/feedburner/feedburnerhostname"]=> string(25) "http://www.feedburner.com" ["feed/feedburner/awareness"]=> string(69) "http://api.feedburner.com/awareness/1.0/GetFeedData?uri=AnalyticsTalk" ["link/uri"]=> string(41) "http://feeds.feedburner.com/AnalyticsTalk" ["link/name"]=> string(14) "Analytics Talk" ["link/id"]=> string(2) "51" } ["magpie"]=> object(MagpieRSS)#87 (19) { ["parser"]=> int(0) ["current_item"]=> array(0) { } ["items"]=> array(10) { [0]=> array(13) { ["title"]=> string(37) "Google Analytics Training in Montreal" ["link"]=> string(58) "http://feeds.feedburner.com/~r/AnalyticsTalk/~3/459827347/" ["comments"]=> string(86) "http://www.epikone.com/blog/2008/11/20/google-analytics-training-in-montreal/#comments" ["pubdate"]=> string(31) "Thu, 20 Nov 2008 17:58:04 +0000" ["dc"]=> array(1) { ["creator"]=> string(14) "Justin Cutroni" } ["category"]=> string(13) "Uncategorized" ["guid"]=> string(34) "http://www.epikone.com/blog/?p=917" ["description"]=> string(295) " Do you live in Montreal or on the East Coast of the US? Want to learn more about how to find actionable data in Google Analytics? Then join us for Google Analytics Seminars for Success in Montreal on December 8 and 9. We&#8217;ve been putting on these training events for almost a year [...]" ["content"]=> array(1) { ["encoded"]=> string(3497) "<p> <img style="border:none;" hspace="7" src="http://www.epikone.com/blog/wp-content/uploads/2008/11/pastedgraphic.tiff" alt="" title="GA Seminar Leader" class="alignright size-full wp-image-921" /><br /> Do you live in Montreal or on the East Coast of the US? Want to learn more about how to find actionable data in <a href="http://analytics.google.com">Google Analytics</a>? Then join us for <a href="http://www.epikone.com/services/training/seminars/">Google Analytics Seminars for Success in Montreal on December 8 and 9</a>.</p> <p>We&#8217;ve been putting on these training events for almost a year now, and, to be honest, I think they are an amazing value. The cost is $249 US per day and our goal is to dump everything we know into your brain. Seriously.</p> <p>Day 1 focuses on the data in GA and how to find actionable information. We cover almost every report and the insights you can draw from each. Also during day 1 we&#8217;ll cover many of the new GA analysis tools including Advanced Segmentation, Custom Reports and Motion Charts. Here&#8217;s a taste of day 1 topics:</p> <ul> <li>Introduction to Web Analytics</li> <li>Website testing with the Google Website Optimizer</li> <li>Google Analytics Reporting Features</li> <li>Sharing GA Data</li> <li>Custom Dashboards</li> <li>Understanding Site Visitors</li> <li>Tracking online marketing campaigns</li> <li>Evaluating site content and user navigation</li> <li>Understanding Goals and Conversion Funnels</li> </ul> <p>On day 2 we really dig into how GA works and how to get it configured correctly. Ever wonder how all that great day gets into GA? We cover that in the morning. Have you been curious about how to use filters and profiles? Yup, we cover that too. We even cover event tracking in the hopes that it will be released from beta soon! :) Treats for day 2 include:</p> <ul> <li>GA architecture overview</li> <li>Learning about Regular Expressions</li> <li>Improving your data with filters</li> <li>Setting up Goals and Funnels</li> <li>Implementing E-Commerce Tracking</li> <li>Configuring Custom Segmentation</li> <li>Introduction to Event Tracking</li> <li>Tracking websites with multiple domains/subdomains</li> <li>Code customization</li> </ul> <p>But I think the best part of Seminars for Success is the interaction. We usually have groups of 60 which is big, but we&#8217;re able to have lively discussions about data and its uses.</p> <p>You can learn more and sign up for Seminars for Success <a href="http://www.epikone.com/services/training/seminars/">here</a>. Got questions? Leave a comment below.</p> <p>And don&#8217;t worry if you can&#8217;t make it to Montreal, we&#8217;ll be doing more of these next year in different cities around the US and hopefully Canada.</p> <div class="feedflare"> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=fkp1n"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=fkp1n" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=VDc8n"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=VDc8n" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=91lln"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=91lln" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=VQV4n"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=VQV4n" border="0"></img></a> </div><img src="http://feeds.feedburner.com/~r/AnalyticsTalk/~4/459827347" height="1" width="1"/>" } ["wfw"]=> array(1) { ["commentrss"]=> string(82) "http://www.epikone.com/blog/2008/11/20/google-analytics-training-in-montreal/feed/" } ["feedburner"]=> array(2) { ["awareness"]=> string(173) "http://api.feedburner.com/awareness/1.0/GetItemData?uri=AnalyticsTalk&itemurl=http%3A%2F%2Fwww.epikone.com%2Fblog%2F2008%2F11%2F20%2Fgoogle-analytics-training-in-montreal%2F" ["origlink"]=> string(77) "http://www.epikone.com/blog/2008/11/20/google-analytics-training-in-montreal/" } ["summary"]=> string(295) " Do you live in Montreal or on the East Coast of the US? Want to learn more about how to find actionable data in Google Analytics? Then join us for Google Analytics Seminars for Success in Montreal on December 8 and 9. We&#8217;ve been putting on these training events for almost a year [...]" ["atom_content"]=> string(3497) "<p> <img style="border:none;" hspace="7" src="http://www.epikone.com/blog/wp-content/uploads/2008/11/pastedgraphic.tiff" alt="" title="GA Seminar Leader" class="alignright size-full wp-image-921" /><br /> Do you live in Montreal or on the East Coast of the US? Want to learn more about how to find actionable data in <a href="http://analytics.google.com">Google Analytics</a>? Then join us for <a href="http://www.epikone.com/services/training/seminars/">Google Analytics Seminars for Success in Montreal on December 8 and 9</a>.</p> <p>We&#8217;ve been putting on these training events for almost a year now, and, to be honest, I think they are an amazing value. The cost is $249 US per day and our goal is to dump everything we know into your brain. Seriously.</p> <p>Day 1 focuses on the data in GA and how to find actionable information. We cover almost every report and the insights you can draw from each. Also during day 1 we&#8217;ll cover many of the new GA analysis tools including Advanced Segmentation, Custom Reports and Motion Charts. Here&#8217;s a taste of day 1 topics:</p> <ul> <li>Introduction to Web Analytics</li> <li>Website testing with the Google Website Optimizer</li> <li>Google Analytics Reporting Features</li> <li>Sharing GA Data</li> <li>Custom Dashboards</li> <li>Understanding Site Visitors</li> <li>Tracking online marketing campaigns</li> <li>Evaluating site content and user navigation</li> <li>Understanding Goals and Conversion Funnels</li> </ul> <p>On day 2 we really dig into how GA works and how to get it configured correctly. Ever wonder how all that great day gets into GA? We cover that in the morning. Have you been curious about how to use filters and profiles? Yup, we cover that too. We even cover event tracking in the hopes that it will be released from beta soon! :) Treats for day 2 include:</p> <ul> <li>GA architecture overview</li> <li>Learning about Regular Expressions</li> <li>Improving your data with filters</li> <li>Setting up Goals and Funnels</li> <li>Implementing E-Commerce Tracking</li> <li>Configuring Custom Segmentation</li> <li>Introduction to Event Tracking</li> <li>Tracking websites with multiple domains/subdomains</li> <li>Code customization</li> </ul> <p>But I think the best part of Seminars for Success is the interaction. We usually have groups of 60 which is big, but we&#8217;re able to have lively discussions about data and its uses.</p> <p>You can learn more and sign up for Seminars for Success <a href="http://www.epikone.com/services/training/seminars/">here</a>. Got questions? Leave a comment below.</p> <p>And don&#8217;t worry if you can&#8217;t make it to Montreal, we&#8217;ll be doing more of these next year in different cities around the US and hopefully Canada.</p> <div class="feedflare"> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=fkp1n"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=fkp1n" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=VDc8n"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=VDc8n" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=91lln"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=91lln" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=VQV4n"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=VQV4n" border="0"></img></a> </div><img src="http://feeds.feedburner.com/~r/AnalyticsTalk/~4/459827347" height="1" width="1"/>" } [1]=> array(13) { ["title"]=> string(36) "Tracking Email with Google Analytics" ["link"]=> string(58) "http://feeds.feedburner.com/~r/AnalyticsTalk/~3/442746121/" ["comments"]=> string(85) "http://www.epikone.com/blog/2008/11/04/email-tracking-with-google-analytics/#comments" ["pubdate"]=> string(31) "Wed, 05 Nov 2008 02:35:30 +0000" ["dc"]=> array(1) { ["creator"]=> string(14) "Justin Cutroni" } ["category"]=> string(104) "analysiscampaign-trackingtrackingweb-analyticscamapign trackingemail-marketingemail-trackinglink-tagging" ["guid"]=> string(34) "http://www.epikone.com/blog/?p=764" ["description"]=> string(330) " In the past few weeks I&#8217;ve gotten a lot of questions about how to track email with Google Analytics. While I did cover the broad topic of online ad tracking in a previous series of posts, email tracking has certain nuances that I think should be addressed. The Concept Tracking email campaigns in Google Analytics is [...]" ["content"]=> array(1) { ["encoded"]=> string(17649) "<p> <img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/emailicon-150x150.png" alt="" title="Email tracking with Google Analytics" width="150" height="150" class="alignright size-thumbnail wp-image-778" /></p> <p>In the past few weeks I&#8217;ve gotten a lot of questions about how to track email with <a href="http://google.com/analytics">Google Analytics</a>. While I did cover the broad topic of online ad tracking in a<a href="http://www.epikone.com/blog/2006/11/10/google-analytics-campaign-tracking-pt-0-an-overview/"> previous series of posts</a>, email tracking has certain nuances that I think should be addressed.</p> <h2>The Concept</h2> <p>Tracking email campaigns in Google Analytics is done using a process called link tagging. This process is the manipulation of the links in your emails. Here&#8217;s a sample link that might appear in an email:</p> <p><code>http://www.mysite.com/page.php</code></p> <p>To track it with Google Analytics it would be modified like this:</p> <p><code>http://www.mysite.com/page.php</code><span style="color:red;"><code>?utm_campaign=fall-sale&amp;utm_medium=email&amp;utm_source=female-list</code></span></p> <p>And another email link that looks like this:</p> <p><code>http://www.mysite.com/page.php?prodid=100</code></p> <p>Should be modified like this:</p> <p><code>http://www.mysite.com/page.php?prodid=100</code><span style="color:red;"><code>&amp;utm_campaign=fall-sale&amp;utm_medium=email&amp;utm_source=female-list</code></span></p> <p>When someone lands on your site after clicking on a tagged link, GA removes the information from the URL and stores it in a cookie. Because the info now resides on your machine (in the cookie) GA can associate all visitor actions (like conversions and transactions) with the email. Pretty slick, huh?</p> <h2>How Link Tagging Works</h2> <p><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/55067140-150x150.jpg" alt="" title="Google Analytics link tagging" width="150" height="150" class="alignright size-thumbnail wp-image-781" hspace="7" /></p> <p>What is all that info I added to the URL? They&#8217;re called link tagging parameters. The name of the parameter is on the left side of the equal sign and the value of the parameter is on the right side. </p> <p>Each parameter represents a different attribute of your email. Looking at the example above we can identifiy the following parameters and their values:</p> <p>utm_campaign=<span style="color:red;">fall-sale</span><br /> utm_medium=<span style="color:red;">email</span><br /> utm_source=<span style="color:red;">female-list</span></p> <p>Each one is identified by the Google Analytics tracking code and helps GA understand that the visitor arrived on your site via an email. </p> <p>You must use the parameters that Google provides. However, you can specify any value for each parameter. This is where the real power lies. By using your own values for each parameter you can add markting information, that is specific to your business, to GA. We&#8217;ll get to where that information appears in a second.</p> <p>[ NOTE: All you advanced user may be calling my bluff here. You can rename the link tagging parameters that GA uses, but it is an advanced technique that requires a change to the GA tracking code. I'm not going to cover it in this post but you can learn more in the <a href="http://www.google.com/support/googleanalytics/bin/answer.py?answer=55577&#038;topic=10998">GA help section</a>. ]</p> <p>Let&#8217;s look at each link tagging parameters and some of the logical values for each.</p> <h3>utm_campaign</h3> <p>This parameter identifies the marketing campaign that the email belongs to. It may be that this email is just one part of a bigger online marketing strategy. For example, you may be using paid search, some display advertising and this email to reach new prospects. You can group this email with other marketing activities by using a common value of utm_campaign.</p> <p>As for suggested values, use something that represents the campaign that your running.</p> <h3>utm_medium</h3> <p>The medium parameter describes how the message got the to visitor. In the case of email I recommend that you always use the same value. I like to use &#8216;email&#8217;. It&#8217;s short and pretty darn descriptive.</p> <p>Using a single value consolidates all email generated traffic into a single line item in the reports.</p> <h3>utm_source</h3> <p>This is where things get interesting. Traditionally, in link tagging, the source is the &#8216;who&#8217; attribute. It describes who you&#8217;re working with to push a message out. But how does the concept of &#8216;who&#8217; map to an email? </p> <p>When it comes to email I like to think of the &#8216;who&#8217; as the list of recipients that you&#8217;re sending the message to. This may be a segment of your email list (like a specific gender segment, age segment of purchase history segment) or your entire email list. For example, some potential utm_source values might be:</p> <p>utm_source=<span style="color:red;">gender:female</span><br /> utm_source=<span style="color:red;">gender:all</span><br /> utm_source=<span style="color:red;">purchase:last-30-days</span><br /> utm_source=<span style="color:red;">purchase:last-60-days</span><br /> utm_source=<span style="color:red;">purchase:free-shipping-offer</span></p> <p>The key here is that by identifying the segment in the utm_source parameter you&#8217;ll be able to measure the performance of that segment in GA. You are segmenting your email list, right?</p> <h3>utm_content</h3> <p><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/anylab-test.jpg" alt="" title="Testing email with Google Analytics." width="233" height="180" class="alignright size-medium wp-image-783" hspace="7" /></p> <p>The final parameter is named utm_content and helps us test emails. The content parameter identifies the actual content of the email. So if you&#8217;re producing different versions of the email for an A/B test you can mesaure the performance of each by varying the value of utm_content. For example:</p> <p>utm_content=<span style="color:red;">free-shipping-offer</span><br /> utm_content=<span style="color:red;">20-off-offer</span><br /> utm_content=<span style="color:red;">product-creative</span><br /> utm_content=<span style="color:red;">value-creative</span></p> <p>Some folks like to use utm_content to describe not only the version of the email that the recipient received, but also the actual location of the link in the email. </p> <p>utm_content=<span style="color:red;">top-nav</span><br /> utm_content=<span style="color:red;">call-to-action</span><br /> utm_content=<span style="color:red;">image-link</span></p> <p>Sometimes this can be overkill as it leads to a lot of very granular data. Normally we just use this to measure which email variation performed better.</p> <p>Think about how powerful this can be. <span style="font-weight:bold;">Using utm_content and utm_source you can measure the performance of a specific message to a specific segment of your customer base (i.e. email list).</span> This is a great way to measure if you&#8217;re sending the right message to the right person!</p> <h2>How to Tag Your Links</h2> <p>So now that we know what paramters we can use to track our email, how do we actually tag the links? It starts by assigning a value to each parameters. You could use the <a href="http://www.google.com/support/analytics/bin/answer.py?hl=en&#038;answer=55578">Google Analytics URL builder</a>: a free tool in the GA help center. Just enter a value for each parameter, along with the URL from your email, and the tool will automatically generate a tagged URL that you can place in your email. </p> <p><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/picture-6.png" alt="" title="Google Analytics URL Builder" width="500" height="356" class="aligncenter size-full wp-image-800" hspace="7" /></p> <p>But I find the URL builder can be cumbersome when tagging a large number of links. Just think of all the links that you might have in a single email!</p> <p>Instead I use a small <a href="http://spreadsheets.google.com/ccc?key=p7c_HKcmspSUfEYSO0gskKw">Google Spreadsheet</a> that has a built in formula. Just enter your campaign values in the columns, along with the URLs from your email, and drag a pre-programmed formula to automatically created your tagged URLs. Then place the URLs in your email.</p> <p><iframe src="http://spreadsheets.google.com/pub?key=p7c_HKcmspSUfEYSO0gskKw" width="500" height="250"></iframe></p> <p>You may have noticed that a tagged URL is pretty ugly. If you&#8217;re sending an HTML email to you can hide the long URL using an anchor tag, but if you&#8217;re using a text based email the recipient will see the entire crappy URL. Try using a service like Tiny URL to hide the query string parameters.</p> <p><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/picture-1.png" alt="Use Tiny URL to shorten an ugly looking tagged URL." title="Tiny URL" width="343" height="129" class="size-full wp-image-766" hspace="7" /></p> <p>I should note that some email platforms (the cool ones!) have begun to integrate GA link tagging into their tools. Check with your email provider to see if they offer this service.</p> <h2>The Reporting</h2> <p>As I mentioned before, the values used in your link tags get pulled directly into Google Analytics. Each parameter becomes the foundation for a report. Let&#8217;s start with the Traffic Sources > Campaigns report:</p> <p><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/picture-3.png" alt="" title="Google Analytics Campaign Report" width="500" height="408" class="aligncenter size-full wp-image-770" hspace="7" /></p> <p>This report lists all the values of your utm_campaign parameters. You can measure the performance of your email campaigns by finding the values you use for utm_campaign. But be aware, this report will also contain the titles of your AdWords ad campaigns. They&#8217;re automatically imported from AdWords. Also remember that you might use the same value of utm_campaign in activities other than email. </p> <p>Remember utm_source and utm_medium? We can drill into a campaign to determine how the email medium, for a specific source, performed in the campaign. Select a campaign by clicking on the name. Then use the dimension drop down to view all the sources within the campaign.</p> <p><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/picture-7.png" alt="" title="Segmenting a campaign in Google Analytics." width="352" height="265" class="aligncenter size-full wp-image-812" /></p> <p><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/picture-8.png" alt="" title="Source value for a campaign." width="424" height="241" class="aligncenter size-full wp-image-814" /></p> <p>The above report shows just one source within this campaign, but that&#8217;s all that was used. The important thing to understand is how you can see certain sources, specifically email segments, contributed to the success of a campaign. </p> <p>But what about evaluating a source across multiple campaigns? Try using the Traffic Sources > All Traffic Sources report:</p> <p><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/picture-4.png" alt="" title="All Traffic Sources Report" width="500" height="432" class="aligncenter size-full wp-image-771" hspace="7" /></p> <p>The first column shows all sources and mediums, so in our case we can see how a segment of the email list performed cross all campaigns. We can quickly filter this report by &#8216;email&#8217;, the medium, to identify how well a segment performed. Remember how </p> <p>What about the utm_content parameter? Where can we find that data? It&#8217;s in the Traffic Sources > Ad Versions report.</p> <p><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/picture-5.png" alt="" title="Google Analytics Ad Versions report" width="500" height="431" class="aligncenter size-full wp-image-775" hspace="7" /></p> <p>Here&#8217;s where we can evaluate the performance of our different email variations. The Ad Versions report not only contains the values from utm_content, but also the titles from your AdWords campaigns. This is another piece of data that GA automatically pulls in.</p> <p><img hspace="7" src="http://www.epikone.com/blog/wp-content/uploads/2008/11/picture-3-300x191.png" alt="" title="Business process." width="300" height="191" class="alignright size-medium wp-image-907" /></p> <p>And let&#8217;s not forget that all of these reports have three tabs full of metrics: site usage, goal conversions and ecommerce (if you choose to use ecommerce tracking). All of these metrics provide insight into the sales or conversion process.</p> <p><a href="http://www.kaushik.net/avinash/2007/08/standard-metrics-revisited-3-bounce-rate.html">Bounce rate</a> provides insight into the begining of the process. A high bounce rate probably indicates a disconnect between the message in the email and the content on the landing page. </p> <p>You can quickly switch to the goal conversions tab to measure the other end of the process by looking at the conversion rate for your email. And if you&#8217;re using the ecommerce tab you can look at a metric like revenue to qualify the conversion rate.</p> <h2>Don&#8217;t Forget the Pre Click Data</h2> <p>While all this data is great, don&#8217;t forget that your email provider has a number of metrics that give insight into what happened before the visitor arrived on your site. Such metrics include # emails sent, # emails received, # bounces, # emails opened and click throughs.</p> <p>I know that metrics like open rate are inherently flawed due to the tracking technology, but you can&#8217;t evaluate things like subject line effectiveness using the data in GA. Don&#8217;t be afraid to look at metrics like # of bounces when evaluating the performance of email.</p> <h2>Create your Advanced Segment</h2> <p>With GA&#8217;s new <a href="http://www.epikone.com/blog/2008/10/22/google-analytics-advanced-segmentation/">Advanced Segments</a> we can really drill into the email traffic segment. At the very least, you should create one advanced segment to evaluate email traffic. </p> <p>To create the advanced segment use the &#8216;medium&#8217; dimension and enter a value of &#8216;email&#8217;. Remember, &#8216;email&#8217; is the value we used for utm_medium in the link tagging. Talk about coming full circle!</p> <p><img src="http://www.epikone.com/blog/wp-content/uploads/2008/11/picture-2.png" alt="" title="Creating a GA email segments" width="483" height="241" class="aligncenter size-full wp-image-906" /></p> <p>Using an advanced segment helps you easily identify what content the email segment found interesting, if they converted, how well the progressed through various processes, etc.</p> <h2>Common Problems</h2> <p>The most common problem we see with link tagging is that people forget to tag their links. Link tagging is usually a process related issue, not a tech related issue. Before your organization sends any email communication make sure the links are tagged.</p> <p>A simple way to test your links is to send the email to a few coworkers and ask them to click on some links. In a few hours you should see the data in your GA reports.</p> <p>The second most common problem has to do with redirects. Many times a site may have a redirect that strips off the campaign tracking parameters. The simple test mentioned above should tell you if you have a redirect issue. Remember, when you click on a tagged link you should see your link tagging parameters in the URL of your site.</p> <h2>A Note on Privacy</h2> <p>A few people have mentioned that it is possible to add a visitor&#8217;s email address to your GA data using link tagging. While this is possible, keep in mind the <a href="http://www.epikone.com/blog/2007/06/26/understanding-the-google-analytics-terms-of-service/">GA terms of service</a> specifically forbids the collection of personally identifiable information with Google Analytics.</p> <p>If you&#8217;re still reading, and you&#8217;re trying to understand how to track other types of online ads, then you may be interested in these posts:</p> <ul> <li><a href="http://www.epikone.com/blog/2006/11/10/google-analytics-campaign-tracking-pt-1-link-tagging/">Google Analytics Campaign Tracking Pt. 1: Link Tagging</a></li> <li><a href="http://www.epikone.com/blog/2006/11/10/google-analytics-campaign-tracking-pt-2-the-epikone-link-tagging-tool/">Part 2: EpikOne Link Tagging Tool</a></li> <li><a href="http://www.epikone.com/blog/2007/03/04/google-analytics-campaign-tracking-part-3-reports-and-analysis/">Part 3: Reports and Analysis</a></li> </ul> <div class="feedflare"> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=UVRPn"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=UVRPn" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=Vsbtn"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=Vsbtn" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=aULbn"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=aULbn" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=zWmUn"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=zWmUn" border="0"></img></a> </div><img src="http://feeds.feedburner.com/~r/AnalyticsTalk/~4/442746121" height="1" width="1"/>" } ["wfw"]=> array(1) { ["commentrss"]=> string(81) "http://www.epikone.com/blog/2008/11/04/email-tracking-with-google-analytics/feed/" } ["feedburner"]=> array(2) { ["awareness"]=> string(172) "http://api.feedburner.com/awareness/1.0/GetItemData?uri=AnalyticsTalk&itemurl=http%3A%2F%2Fwww.epikone.com%2Fblog%2F2008%2F11%2F04%2Femail-tracking-with-google-analytics%2F" ["origlink"]=> string(76) "http://www.epikone.com/blog/2008/11/04/email-tracking-with-google-analytics/" } ["summary"]=> string(330) " In the past few weeks I&#8217;ve gotten a lot of questions about how to track email with Google Analytics. While I did cover the broad topic of online ad tracking in a previous series of posts, email tracking has certain nuances that I think should be addressed. The Concept Tracking email campaigns in Google Analytics is [...]" ["atom_content"]=> string(17649) "<p> <img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/emailicon-150x150.png" alt="" title="Email tracking with Google Analytics" width="150" height="150" class="alignright size-thumbnail wp-image-778" /></p> <p>In the past few weeks I&#8217;ve gotten a lot of questions about how to track email with <a href="http://google.com/analytics">Google Analytics</a>. While I did cover the broad topic of online ad tracking in a<a href="http://www.epikone.com/blog/2006/11/10/google-analytics-campaign-tracking-pt-0-an-overview/"> previous series of posts</a>, email tracking has certain nuances that I think should be addressed.</p> <h2>The Concept</h2> <p>Tracking email campaigns in Google Analytics is done using a process called link tagging. This process is the manipulation of the links in your emails. Here&#8217;s a sample link that might appear in an email:</p> <p><code>http://www.mysite.com/page.php</code></p> <p>To track it with Google Analytics it would be modified like this:</p> <p><code>http://www.mysite.com/page.php</code><span style="color:red;"><code>?utm_campaign=fall-sale&amp;utm_medium=email&amp;utm_source=female-list</code></span></p> <p>And another email link that looks like this:</p> <p><code>http://www.mysite.com/page.php?prodid=100</code></p> <p>Should be modified like this:</p> <p><code>http://www.mysite.com/page.php?prodid=100</code><span style="color:red;"><code>&amp;utm_campaign=fall-sale&amp;utm_medium=email&amp;utm_source=female-list</code></span></p> <p>When someone lands on your site after clicking on a tagged link, GA removes the information from the URL and stores it in a cookie. Because the info now resides on your machine (in the cookie) GA can associate all visitor actions (like conversions and transactions) with the email. Pretty slick, huh?</p> <h2>How Link Tagging Works</h2> <p><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/55067140-150x150.jpg" alt="" title="Google Analytics link tagging" width="150" height="150" class="alignright size-thumbnail wp-image-781" hspace="7" /></p> <p>What is all that info I added to the URL? They&#8217;re called link tagging parameters. The name of the parameter is on the left side of the equal sign and the value of the parameter is on the right side. </p> <p>Each parameter represents a different attribute of your email. Looking at the example above we can identifiy the following parameters and their values:</p> <p>utm_campaign=<span style="color:red;">fall-sale</span><br /> utm_medium=<span style="color:red;">email</span><br /> utm_source=<span style="color:red;">female-list</span></p> <p>Each one is identified by the Google Analytics tracking code and helps GA understand that the visitor arrived on your site via an email. </p> <p>You must use the parameters that Google provides. However, you can specify any value for each parameter. This is where the real power lies. By using your own values for each parameter you can add markting information, that is specific to your business, to GA. We&#8217;ll get to where that information appears in a second.</p> <p>[ NOTE: All you advanced user may be calling my bluff here. You can rename the link tagging parameters that GA uses, but it is an advanced technique that requires a change to the GA tracking code. I'm not going to cover it in this post but you can learn more in the <a href="http://www.google.com/support/googleanalytics/bin/answer.py?answer=55577&#038;topic=10998">GA help section</a>. ]</p> <p>Let&#8217;s look at each link tagging parameters and some of the logical values for each.</p> <h3>utm_campaign</h3> <p>This parameter identifies the marketing campaign that the email belongs to. It may be that this email is just one part of a bigger online marketing strategy. For example, you may be using paid search, some display advertising and this email to reach new prospects. You can group this email with other marketing activities by using a common value of utm_campaign.</p> <p>As for suggested values, use something that represents the campaign that your running.</p> <h3>utm_medium</h3> <p>The medium parameter describes how the message got the to visitor. In the case of email I recommend that you always use the same value. I like to use &#8216;email&#8217;. It&#8217;s short and pretty darn descriptive.</p> <p>Using a single value consolidates all email generated traffic into a single line item in the reports.</p> <h3>utm_source</h3> <p>This is where things get interesting. Traditionally, in link tagging, the source is the &#8216;who&#8217; attribute. It describes who you&#8217;re working with to push a message out. But how does the concept of &#8216;who&#8217; map to an email? </p> <p>When it comes to email I like to think of the &#8216;who&#8217; as the list of recipients that you&#8217;re sending the message to. This may be a segment of your email list (like a specific gender segment, age segment of purchase history segment) or your entire email list. For example, some potential utm_source values might be:</p> <p>utm_source=<span style="color:red;">gender:female</span><br /> utm_source=<span style="color:red;">gender:all</span><br /> utm_source=<span style="color:red;">purchase:last-30-days</span><br /> utm_source=<span style="color:red;">purchase:last-60-days</span><br /> utm_source=<span style="color:red;">purchase:free-shipping-offer</span></p> <p>The key here is that by identifying the segment in the utm_source parameter you&#8217;ll be able to measure the performance of that segment in GA. You are segmenting your email list, right?</p> <h3>utm_content</h3> <p><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/anylab-test.jpg" alt="" title="Testing email with Google Analytics." width="233" height="180" class="alignright size-medium wp-image-783" hspace="7" /></p> <p>The final parameter is named utm_content and helps us test emails. The content parameter identifies the actual content of the email. So if you&#8217;re producing different versions of the email for an A/B test you can mesaure the performance of each by varying the value of utm_content. For example:</p> <p>utm_content=<span style="color:red;">free-shipping-offer</span><br /> utm_content=<span style="color:red;">20-off-offer</span><br /> utm_content=<span style="color:red;">product-creative</span><br /> utm_content=<span style="color:red;">value-creative</span></p> <p>Some folks like to use utm_content to describe not only the version of the email that the recipient received, but also the actual location of the link in the email. </p> <p>utm_content=<span style="color:red;">top-nav</span><br /> utm_content=<span style="color:red;">call-to-action</span><br /> utm_content=<span style="color:red;">image-link</span></p> <p>Sometimes this can be overkill as it leads to a lot of very granular data. Normally we just use this to measure which email variation performed better.</p> <p>Think about how powerful this can be. <span style="font-weight:bold;">Using utm_content and utm_source you can measure the performance of a specific message to a specific segment of your customer base (i.e. email list).</span> This is a great way to measure if you&#8217;re sending the right message to the right person!</p> <h2>How to Tag Your Links</h2> <p>So now that we know what paramters we can use to track our email, how do we actually tag the links? It starts by assigning a value to each parameters. You could use the <a href="http://www.google.com/support/analytics/bin/answer.py?hl=en&#038;answer=55578">Google Analytics URL builder</a>: a free tool in the GA help center. Just enter a value for each parameter, along with the URL from your email, and the tool will automatically generate a tagged URL that you can place in your email. </p> <p><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/picture-6.png" alt="" title="Google Analytics URL Builder" width="500" height="356" class="aligncenter size-full wp-image-800" hspace="7" /></p> <p>But I find the URL builder can be cumbersome when tagging a large number of links. Just think of all the links that you might have in a single email!</p> <p>Instead I use a small <a href="http://spreadsheets.google.com/ccc?key=p7c_HKcmspSUfEYSO0gskKw">Google Spreadsheet</a> that has a built in formula. Just enter your campaign values in the columns, along with the URLs from your email, and drag a pre-programmed formula to automatically created your tagged URLs. Then place the URLs in your email.</p> <p><iframe src="http://spreadsheets.google.com/pub?key=p7c_HKcmspSUfEYSO0gskKw" width="500" height="250"></iframe></p> <p>You may have noticed that a tagged URL is pretty ugly. If you&#8217;re sending an HTML email to you can hide the long URL using an anchor tag, but if you&#8217;re using a text based email the recipient will see the entire crappy URL. Try using a service like Tiny URL to hide the query string parameters.</p> <p><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/picture-1.png" alt="Use Tiny URL to shorten an ugly looking tagged URL." title="Tiny URL" width="343" height="129" class="size-full wp-image-766" hspace="7" /></p> <p>I should note that some email platforms (the cool ones!) have begun to integrate GA link tagging into their tools. Check with your email provider to see if they offer this service.</p> <h2>The Reporting</h2> <p>As I mentioned before, the values used in your link tags get pulled directly into Google Analytics. Each parameter becomes the foundation for a report. Let&#8217;s start with the Traffic Sources > Campaigns report:</p> <p><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/picture-3.png" alt="" title="Google Analytics Campaign Report" width="500" height="408" class="aligncenter size-full wp-image-770" hspace="7" /></p> <p>This report lists all the values of your utm_campaign parameters. You can measure the performance of your email campaigns by finding the values you use for utm_campaign. But be aware, this report will also contain the titles of your AdWords ad campaigns. They&#8217;re automatically imported from AdWords. Also remember that you might use the same value of utm_campaign in activities other than email. </p> <p>Remember utm_source and utm_medium? We can drill into a campaign to determine how the email medium, for a specific source, performed in the campaign. Select a campaign by clicking on the name. Then use the dimension drop down to view all the sources within the campaign.</p> <p><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/picture-7.png" alt="" title="Segmenting a campaign in Google Analytics." width="352" height="265" class="aligncenter size-full wp-image-812" /></p> <p><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/picture-8.png" alt="" title="Source value for a campaign." width="424" height="241" class="aligncenter size-full wp-image-814" /></p> <p>The above report shows just one source within this campaign, but that&#8217;s all that was used. The important thing to understand is how you can see certain sources, specifically email segments, contributed to the success of a campaign. </p> <p>But what about evaluating a source across multiple campaigns? Try using the Traffic Sources > All Traffic Sources report:</p> <p><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/picture-4.png" alt="" title="All Traffic Sources Report" width="500" height="432" class="aligncenter size-full wp-image-771" hspace="7" /></p> <p>The first column shows all sources and mediums, so in our case we can see how a segment of the email list performed cross all campaigns. We can quickly filter this report by &#8216;email&#8217;, the medium, to identify how well a segment performed. Remember how </p> <p>What about the utm_content parameter? Where can we find that data? It&#8217;s in the Traffic Sources > Ad Versions report.</p> <p><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/picture-5.png" alt="" title="Google Analytics Ad Versions report" width="500" height="431" class="aligncenter size-full wp-image-775" hspace="7" /></p> <p>Here&#8217;s where we can evaluate the performance of our different email variations. The Ad Versions report not only contains the values from utm_content, but also the titles from your AdWords campaigns. This is another piece of data that GA automatically pulls in.</p> <p><img hspace="7" src="http://www.epikone.com/blog/wp-content/uploads/2008/11/picture-3-300x191.png" alt="" title="Business process." width="300" height="191" class="alignright size-medium wp-image-907" /></p> <p>And let&#8217;s not forget that all of these reports have three tabs full of metrics: site usage, goal conversions and ecommerce (if you choose to use ecommerce tracking). All of these metrics provide insight into the sales or conversion process.</p> <p><a href="http://www.kaushik.net/avinash/2007/08/standard-metrics-revisited-3-bounce-rate.html">Bounce rate</a> provides insight into the begining of the process. A high bounce rate probably indicates a disconnect between the message in the email and the content on the landing page. </p> <p>You can quickly switch to the goal conversions tab to measure the other end of the process by looking at the conversion rate for your email. And if you&#8217;re using the ecommerce tab you can look at a metric like revenue to qualify the conversion rate.</p> <h2>Don&#8217;t Forget the Pre Click Data</h2> <p>While all this data is great, don&#8217;t forget that your email provider has a number of metrics that give insight into what happened before the visitor arrived on your site. Such metrics include # emails sent, # emails received, # bounces, # emails opened and click throughs.</p> <p>I know that metrics like open rate are inherently flawed due to the tracking technology, but you can&#8217;t evaluate things like subject line effectiveness using the data in GA. Don&#8217;t be afraid to look at metrics like # of bounces when evaluating the performance of email.</p> <h2>Create your Advanced Segment</h2> <p>With GA&#8217;s new <a href="http://www.epikone.com/blog/2008/10/22/google-analytics-advanced-segmentation/">Advanced Segments</a> we can really drill into the email traffic segment. At the very least, you should create one advanced segment to evaluate email traffic. </p> <p>To create the advanced segment use the &#8216;medium&#8217; dimension and enter a value of &#8216;email&#8217;. Remember, &#8216;email&#8217; is the value we used for utm_medium in the link tagging. Talk about coming full circle!</p> <p><img src="http://www.epikone.com/blog/wp-content/uploads/2008/11/picture-2.png" alt="" title="Creating a GA email segments" width="483" height="241" class="aligncenter size-full wp-image-906" /></p> <p>Using an advanced segment helps you easily identify what content the email segment found interesting, if they converted, how well the progressed through various processes, etc.</p> <h2>Common Problems</h2> <p>The most common problem we see with link tagging is that people forget to tag their links. Link tagging is usually a process related issue, not a tech related issue. Before your organization sends any email communication make sure the links are tagged.</p> <p>A simple way to test your links is to send the email to a few coworkers and ask them to click on some links. In a few hours you should see the data in your GA reports.</p> <p>The second most common problem has to do with redirects. Many times a site may have a redirect that strips off the campaign tracking parameters. The simple test mentioned above should tell you if you have a redirect issue. Remember, when you click on a tagged link you should see your link tagging parameters in the URL of your site.</p> <h2>A Note on Privacy</h2> <p>A few people have mentioned that it is possible to add a visitor&#8217;s email address to your GA data using link tagging. While this is possible, keep in mind the <a href="http://www.epikone.com/blog/2007/06/26/understanding-the-google-analytics-terms-of-service/">GA terms of service</a> specifically forbids the collection of personally identifiable information with Google Analytics.</p> <p>If you&#8217;re still reading, and you&#8217;re trying to understand how to track other types of online ads, then you may be interested in these posts:</p> <ul> <li><a href="http://www.epikone.com/blog/2006/11/10/google-analytics-campaign-tracking-pt-1-link-tagging/">Google Analytics Campaign Tracking Pt. 1: Link Tagging</a></li> <li><a href="http://www.epikone.com/blog/2006/11/10/google-analytics-campaign-tracking-pt-2-the-epikone-link-tagging-tool/">Part 2: EpikOne Link Tagging Tool</a></li> <li><a href="http://www.epikone.com/blog/2007/03/04/google-analytics-campaign-tracking-part-3-reports-and-analysis/">Part 3: Reports and Analysis</a></li> </ul> <div class="feedflare"> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=UVRPn"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=UVRPn" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=Vsbtn"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=Vsbtn" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=aULbn"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=aULbn" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=zWmUn"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=zWmUn" border="0"></img></a> </div><img src="http://feeds.feedburner.com/~r/AnalyticsTalk/~4/442746121" height="1" width="1"/>" } [2]=> array(13) { ["title"]=> string(45) "Adding Business Data to Google Analytics Data" ["link"]=> string(58) "http://feeds.feedburner.com/~r/AnalyticsTalk/~3/435444258/" ["comments"]=> string(94) "http://www.epikone.com/blog/2008/10/28/adding-business-data-to-google-analytics-data/#comments" ["pubdate"]=> string(31) "Wed, 29 Oct 2008 04:15:33 +0000" ["dc"]=> array(1) { ["creator"]=> string(14) "Justin Cutroni" } ["category"]=> string(39) "analysisresourcestipsconfigurationtools" ["guid"]=> string(34) "http://www.epikone.com/blog/?p=879" ["description"]=> string(326) " I know the past week has been full of Google Analytics news, but I&#8217;m excited to tell you about something one of our team members created: Google Analytics Notes. For a long time we&#8217;ve wanted to add business data to GA to help keep track of marketing activities, industry news and GA configuration changes. [...]" ["content"]=> array(1) { ["encoded"]=> string(5550) "<p> <img hspace="7" src="http://www.epikone.com/blog/wp-content/uploads/2008/10/postit_note-150x150.jpg" alt="" title="Post It Note! Wouldn&#039;t it be cool to add them to Google Analytics?" width="150" height="150" class="alignright size-thumbnail wp-image-881" style="border:0px;" /></p> <p>I know the past week has been full of <a href="http://analytics.blogspot.com/">Google Analytics</a> news, but I&#8217;m excited to tell you about something one of our team members created: Google Analytics Notes.</p> <p>For a long time we&#8217;ve wanted to add business data to GA to help keep track of marketing activities, industry news and GA configuration changes. These things are critical to know when analyzing data as they add more context and help us understand what&#8217;s affecting website performance.</p> <p>We tried using <a href="http://docs.google.com/">Google Spreadsheets</a> to store business info but it never worked. People did not take the time to open up a spreadsheet and add information. We figured that adding some type of &#8216;note&#8217; functionality to GA would be the easiest way to change this behavior. That&#8217;s how GA Notes was born.</p> <p>GA Notes is a <a href="http://en.wikipedia.org/wiki/Firefox_extension">Firefox extension</a> that lets you add business data to a profile. Notes appear in a concealable table at the top of every report.</p> <p><a href="http://www.epikone.com/blog/wp-content/uploads/2008/10/picture-41.png"><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/picture-41.png" alt="" title="Business data in Google Analytics." width="500" height="148" class="aligncenter size-full wp-image-884" /></a></p> <p>Any GA user who views a profile, and has the Firefox extension, will see the notes entered for the profile. You can add notes, edit notes and delete notes. Notes can also be exported in XML format for archival purposes.</p> <p><object width="425" height="350"><param name="movie" value="http://www.youtube.com/v/gAgikPKFuI0"></param> <embed src="http://www.youtube.com/v/gAgikPKFuI0" type="application/x-shockwave-flash" width="425" height="350"></embed></object></p> <h2>Installation</h2> <p>Installing GA Notes is easy. Just download the following file to your computer: </p> <p><a href="https://ga-notes.appspot.com/ganotes.xpi" onClick="pageTracker.trackPageview('/blog/files/ganote.xpi');">https://ga-notes.appspot.com/ganotes.xpi<br /> </a></p> <p>Once downloaded double click on the file. Firefox should open and ask if you want to install the extension. Click install and that&#8217;s it. You&#8217;re ready to start adding notes to your GA data.</p> <p><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/picture-31.png" alt="" title="Adding business notes to Google Analytics." width="229" height="86" class="aligncenter size-full wp-image-880" /></p> <h2>Usage</h2> <p>The extension adds a &#8216;Show Notes&#8217; button in the GA menu bar. Click on the button to view notes for this profile or to add a note or edit/delete an existing note. It&#8217;s not that complicated. :) We wanted to keep this easy and flexible.</p> <h2>How it Works</h2> <p>For those of you that are interested, GA Notes runs on <a href="http://code.google.com/appengine/">Google&#8217;s App Engine</a>. No data is stored on your machine or our servers. It&#8217;s stored on Google&#8217;s servers. The Firefox extension provides the interface to enter and display data. But all of the processing and data storage happens on App Engine. All data sent to App Engine is encrypted prior to transmission.</p> <p>In a perfect world we would have added notes to the data-over-time graph at the top of each report. However, we can&#8217;t get inside that part of GA using a Firefox extensions (or <a href="https://addons.mozilla.org/en-US/firefox/addon/748">Greasemonkey</a> script). We thought this was a good compromise. If anyone out there knows how to dig into Flash let us know! :)</p> <h2>Road Map</h2> <p>This is obviously a beta version of the software. We have a number of features that we&#8217;re working on and hope to have done soon. These include:</p> <ul> <li>Sorting and searching notes by date</li> <li>Excel friendly export</li> <li>An admin flag for notes to separate admin changes to your GA account</li> <li>Some type of alert to show you how many new notes have been added since your last login</li> <li>A more graphical visualization of note</li> </ul> <p>If you have any suggestions or ideas please <a href="http://cegner.wufoo.com/forms/ga-notes-feedback-form/">let us know</a>!</p> <h2>Credit</h2> <p>I don&#8217;t have the smarts to build these types of things, I just know enough to be dangerous. Chris, a new member of our team, built GA Notes from the ground up. Thanks Chris for all the hard work.</p> <div class="feedflare"> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=6FbIm"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=6FbIm" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=Nalym"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=Nalym" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=sNTum"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=sNTum" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=hPFim"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=hPFim" border="0"></img></a> </div><img src="http://feeds.feedburner.com/~r/AnalyticsTalk/~4/435444258" height="1" width="1"/>" } ["wfw"]=> array(1) { ["commentrss"]=> string(90) "http://www.epikone.com/blog/2008/10/28/adding-business-data-to-google-analytics-data/feed/" } ["feedburner"]=> array(2) { ["awareness"]=> string(181) "http://api.feedburner.com/awareness/1.0/GetItemData?uri=AnalyticsTalk&itemurl=http%3A%2F%2Fwww.epikone.com%2Fblog%2F2008%2F10%2F28%2Fadding-business-data-to-google-analytics-data%2F" ["origlink"]=> string(85) "http://www.epikone.com/blog/2008/10/28/adding-business-data-to-google-analytics-data/" } ["summary"]=> string(326) " I know the past week has been full of Google Analytics news, but I&#8217;m excited to tell you about something one of our team members created: Google Analytics Notes. For a long time we&#8217;ve wanted to add business data to GA to help keep track of marketing activities, industry news and GA configuration changes. [...]" ["atom_content"]=> string(5550) "<p> <img hspace="7" src="http://www.epikone.com/blog/wp-content/uploads/2008/10/postit_note-150x150.jpg" alt="" title="Post It Note! Wouldn&#039;t it be cool to add them to Google Analytics?" width="150" height="150" class="alignright size-thumbnail wp-image-881" style="border:0px;" /></p> <p>I know the past week has been full of <a href="http://analytics.blogspot.com/">Google Analytics</a> news, but I&#8217;m excited to tell you about something one of our team members created: Google Analytics Notes.</p> <p>For a long time we&#8217;ve wanted to add business data to GA to help keep track of marketing activities, industry news and GA configuration changes. These things are critical to know when analyzing data as they add more context and help us understand what&#8217;s affecting website performance.</p> <p>We tried using <a href="http://docs.google.com/">Google Spreadsheets</a> to store business info but it never worked. People did not take the time to open up a spreadsheet and add information. We figured that adding some type of &#8216;note&#8217; functionality to GA would be the easiest way to change this behavior. That&#8217;s how GA Notes was born.</p> <p>GA Notes is a <a href="http://en.wikipedia.org/wiki/Firefox_extension">Firefox extension</a> that lets you add business data to a profile. Notes appear in a concealable table at the top of every report.</p> <p><a href="http://www.epikone.com/blog/wp-content/uploads/2008/10/picture-41.png"><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/picture-41.png" alt="" title="Business data in Google Analytics." width="500" height="148" class="aligncenter size-full wp-image-884" /></a></p> <p>Any GA user who views a profile, and has the Firefox extension, will see the notes entered for the profile. You can add notes, edit notes and delete notes. Notes can also be exported in XML format for archival purposes.</p> <p><object width="425" height="350"><param name="movie" value="http://www.youtube.com/v/gAgikPKFuI0"></param> <embed src="http://www.youtube.com/v/gAgikPKFuI0" type="application/x-shockwave-flash" width="425" height="350"></embed></object></p> <h2>Installation</h2> <p>Installing GA Notes is easy. Just download the following file to your computer: </p> <p><a href="https://ga-notes.appspot.com/ganotes.xpi" onClick="pageTracker.trackPageview('/blog/files/ganote.xpi');">https://ga-notes.appspot.com/ganotes.xpi<br /> </a></p> <p>Once downloaded double click on the file. Firefox should open and ask if you want to install the extension. Click install and that&#8217;s it. You&#8217;re ready to start adding notes to your GA data.</p> <p><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/picture-31.png" alt="" title="Adding business notes to Google Analytics." width="229" height="86" class="aligncenter size-full wp-image-880" /></p> <h2>Usage</h2> <p>The extension adds a &#8216;Show Notes&#8217; button in the GA menu bar. Click on the button to view notes for this profile or to add a note or edit/delete an existing note. It&#8217;s not that complicated. :) We wanted to keep this easy and flexible.</p> <h2>How it Works</h2> <p>For those of you that are interested, GA Notes runs on <a href="http://code.google.com/appengine/">Google&#8217;s App Engine</a>. No data is stored on your machine or our servers. It&#8217;s stored on Google&#8217;s servers. The Firefox extension provides the interface to enter and display data. But all of the processing and data storage happens on App Engine. All data sent to App Engine is encrypted prior to transmission.</p> <p>In a perfect world we would have added notes to the data-over-time graph at the top of each report. However, we can&#8217;t get inside that part of GA using a Firefox extensions (or <a href="https://addons.mozilla.org/en-US/firefox/addon/748">Greasemonkey</a> script). We thought this was a good compromise. If anyone out there knows how to dig into Flash let us know! :)</p> <h2>Road Map</h2> <p>This is obviously a beta version of the software. We have a number of features that we&#8217;re working on and hope to have done soon. These include:</p> <ul> <li>Sorting and searching notes by date</li> <li>Excel friendly export</li> <li>An admin flag for notes to separate admin changes to your GA account</li> <li>Some type of alert to show you how many new notes have been added since your last login</li> <li>A more graphical visualization of note</li> </ul> <p>If you have any suggestions or ideas please <a href="http://cegner.wufoo.com/forms/ga-notes-feedback-form/">let us know</a>!</p> <h2>Credit</h2> <p>I don&#8217;t have the smarts to build these types of things, I just know enough to be dangerous. Chris, a new member of our team, built GA Notes from the ground up. Thanks Chris for all the hard work.</p> <div class="feedflare"> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=6FbIm"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=6FbIm" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=Nalym"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=Nalym" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=sNTum"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=sNTum" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=hPFim"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=hPFim" border="0"></img></a> </div><img src="http://feeds.feedburner.com/~r/AnalyticsTalk/~4/435444258" height="1" width="1"/>" } [3]=> array(13) { ["title"]=> string(28) "Google Analytics Version 3.0" ["link"]=> string(58) "http://feeds.feedburner.com/~r/AnalyticsTalk/~3/428829789/" ["comments"]=> string(76) "http://www.epikone.com/blog/2008/10/22/google-analytics-version-30/#comments" ["pubdate"]=> string(31) "Wed, 22 Oct 2008 18:35:47 +0000" ["dc"]=> array(1) { ["creator"]=> string(14) "Justin Cutroni" } ["category"]=> string(20) "about gafeaturesv3.0" ["guid"]=> string(34) "http://www.epikone.com/blog/?p=837" ["description"]=> string(351) " Today Google is releasing a significant update to Google Analytics. I&#8217;m not sure if it is officially version 3.0, but the amount of new functionality is extraordinary. Not to mention some nice changes to the interface to clean things up. This new release includes: * Motion Charts (a data visualization tool) * Advanced Segmentation * [...]" ["content"]=> array(1) { ["encoded"]=> string(2911) "<p> <object width="425" height="350"><param name="movie" value="http://www.youtube.com/v/IePzWyIbIyI"></param> <embed src="http://www.youtube.com/v/IePzWyIbIyI" type="application/x-shockwave-flash" width="425" height="350"></embed></object></p> <p>Today Google is releasing a significant update to Google Analytics. I&#8217;m not sure if it is officially version 3.0, but the amount of new functionality is extraordinary. Not to mention some nice changes to the interface to clean things up.</p> <p>This new release includes:</p> <p>* Motion Charts (a data visualization tool)<br /> * <a href="http://www.epikone.com/blog/2008/10/22/google-analytics-advanced-segmentation">Advanced Segmentation</a><br /> * Custom Reporting<br /> * AdSense Integration<br /> * A data API<br /> * <a href="http://www.epikone.com/blog/2008/10/22/getting-to-know-the-new-google-analytics-admin-interface">A new administrative interface</a></p> <p>Not all of these features are public. The API and AdSense reports (I believe) are in private beta meaning your account must be authorized to use them. All other features are public! Woo Hoo!</p> <p>These new features cover 90% of the requests we get from all users, both big and small. In my opinion this release is game changer, especially for the enterprise market. </p> <p>For example, our ability to manage massive GA implementations (1,000 + sites) is now much easier with the new administrative interface. And the data API let&#8217;s companies integrate their click stream data with other data sources. Did I mention that <a href="http://www.epikone.com/blog/2008/10/22/google-analytics-advanced-segmentation">Advanced Segmentation</a> let&#8217;s you segment historical data?</p> <p>I&#8217;ll slowly be rolling out some posts and to cover all new features as well as a few posts to discuss how this changes the way we work with GA.</p> <p>A big congratulations to the Google Analytics team. The amount of new functionality is really amazing.</p> <p><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/party-time-for-ga.jpg" alt="" title="New GA! Party Time!" width="454" height="300" class="aligncenter size-full wp-image-841" /></p> <div class="feedflare"> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=tm3Tm"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=tm3Tm" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=Ci3Bm"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=Ci3Bm" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=uM1vm"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=uM1vm" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=xiGFm"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=xiGFm" border="0"></img></a> </div><img src="http://feeds.feedburner.com/~r/AnalyticsTalk/~4/428829789" height="1" width="1"/>" } ["wfw"]=> array(1) { ["commentrss"]=> string(72) "http://www.epikone.com/blog/2008/10/22/google-analytics-version-30/feed/" } ["feedburner"]=> array(2) { ["awareness"]=> string(163) "http://api.feedburner.com/awareness/1.0/GetItemData?uri=AnalyticsTalk&itemurl=http%3A%2F%2Fwww.epikone.com%2Fblog%2F2008%2F10%2F22%2Fgoogle-analytics-version-30%2F" ["origlink"]=> string(67) "http://www.epikone.com/blog/2008/10/22/google-analytics-version-30/" } ["summary"]=> string(351) " Today Google is releasing a significant update to Google Analytics. I&#8217;m not sure if it is officially version 3.0, but the amount of new functionality is extraordinary. Not to mention some nice changes to the interface to clean things up. This new release includes: * Motion Charts (a data visualization tool) * Advanced Segmentation * [...]" ["atom_content"]=> string(2911) "<p> <object width="425" height="350"><param name="movie" value="http://www.youtube.com/v/IePzWyIbIyI"></param> <embed src="http://www.youtube.com/v/IePzWyIbIyI" type="application/x-shockwave-flash" width="425" height="350"></embed></object></p> <p>Today Google is releasing a significant update to Google Analytics. I&#8217;m not sure if it is officially version 3.0, but the amount of new functionality is extraordinary. Not to mention some nice changes to the interface to clean things up.</p> <p>This new release includes:</p> <p>* Motion Charts (a data visualization tool)<br /> * <a href="http://www.epikone.com/blog/2008/10/22/google-analytics-advanced-segmentation">Advanced Segmentation</a><br /> * Custom Reporting<br /> * AdSense Integration<br /> * A data API<br /> * <a href="http://www.epikone.com/blog/2008/10/22/getting-to-know-the-new-google-analytics-admin-interface">A new administrative interface</a></p> <p>Not all of these features are public. The API and AdSense reports (I believe) are in private beta meaning your account must be authorized to use them. All other features are public! Woo Hoo!</p> <p>These new features cover 90% of the requests we get from all users, both big and small. In my opinion this release is game changer, especially for the enterprise market. </p> <p>For example, our ability to manage massive GA implementations (1,000 + sites) is now much easier with the new administrative interface. And the data API let&#8217;s companies integrate their click stream data with other data sources. Did I mention that <a href="http://www.epikone.com/blog/2008/10/22/google-analytics-advanced-segmentation">Advanced Segmentation</a> let&#8217;s you segment historical data?</p> <p>I&#8217;ll slowly be rolling out some posts and to cover all new features as well as a few posts to discuss how this changes the way we work with GA.</p> <p>A big congratulations to the Google Analytics team. The amount of new functionality is really amazing.</p> <p><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/party-time-for-ga.jpg" alt="" title="New GA! Party Time!" width="454" height="300" class="aligncenter size-full wp-image-841" /></p> <div class="feedflare"> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=tm3Tm"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=tm3Tm" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=Ci3Bm"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=Ci3Bm" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=uM1vm"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=uM1vm" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=xiGFm"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=xiGFm" border="0"></img></a> </div><img src="http://feeds.feedburner.com/~r/AnalyticsTalk/~4/428829789" height="1" width="1"/>" } [4]=> array(13) { ["title"]=> string(56) "Getting to Know the New Google Analytics Admin Interface" ["link"]=> string(58) "http://feeds.feedburner.com/~r/AnalyticsTalk/~3/428829783/" ["comments"]=> string(105) "http://www.epikone.com/blog/2008/10/22/getting-to-know-the-new-google-analytics-admin-interface/#comments" ["pubdate"]=> string(31) "Wed, 22 Oct 2008 18:34:25 +0000" ["dc"]=> array(1) { ["creator"]=> string(14) "Justin Cutroni" } ["category"]=> string(33) "about gaanalysisfeaturessetupv3.0" ["guid"]=> string(34) "http://www.epikone.com/blog/?p=817" ["description"]=> string(286) " One part of Google Analytics that has seen very little love over the past few years is the administrative interface. Not any more! Google has rolled out a beta version of a new GA management tool that will have an immediate impact on how we set up and manage Google Analytics. [...]" ["content"]=> array(1) { ["encoded"]=> string(5396) "<p> One part of Google Analytics that has seen very little love over the past few years is the administrative interface. Not any more! Google has rolled out a beta version of a new GA management tool that will have an immediate impact on how we set up and manage Google Analytics. </p> <p>When you firs log in the new admin area will display a list of all accounts that you have access to.</p> <p><a href="http://www.epikone.com/blog/wp-content/uploads/2008/10/admin-accounts.jpg"><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/admin-accounts-300x135.jpg" alt="" title="New Google Analytics Admin Interface" width="300" height="135" class="aligncenter size-medium wp-image-820" /></a><br /> Click to enlarge the image.</p> <p>This tabular layout of accounts is new, and very helpful. If you&#8217;re an agency, or a large company, you probably have access to multiple GA accounts. This layout makes it easy to identify performance at the account level.</p> <p>Key to the new layout is the addition of metrics. Available metrics in are:</p> <p>* Visits<br /> * Time on Site<br /> * Bounce Rate<br /> * Completed Goals</p> <p>One column actually does a date comparison. Choose one of the above metrics using the drop down at the top of the column and a simple date range using the buttons at the top right corner of the screen to determine how said metric has changed over the past day, week, month or year.</p> <p>Looking a bit closer, you&#8217;ll notice that each account name is a link. Clicking on the link will display all profiles within that account:</p> <p><a href="http://www.epikone.com/blog/wp-content/uploads/2008/10/new-admin-profile-view.jpg"><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/new-admin-profile-view-300x203.jpg" alt="" title="New GA Admin Interface - Profile View" width="300" height="203" class="aligncenter size-medium wp-image-825" /></a><br /> click to enlarge.</p> <p>This is where things get really juicy!</p> <p>GA is now grouping the profiles that have been created for each tracking code in an account. I&#8217;ve talked a lot about <a href="http://www.epikone.com/blog/2007/07/17/segmenting-visitor-loyalty-reports-in-ga/">creating multiple profiles for a single site</a>, and this is a great way to see all those properties in one place.</p> <p>As an analyst I like the fact that I can view basic information in the admin area and do a quick performance evaluation. Would I like to see more metrics? Sure, but this is a great start. This literally turns the admin area into a basic dashboard for large groups of websites.</p> <p>Another feature that I really like is the Favorites. Anyone that uses other Google products (like <a href="http://mail.google.com">GMail</a> or <a href="http://docs.google.com">GDocs</a>) will recognize this. </p> <p>You can &#8217;star&#8217; certain profiles and then display only those that you starred. This makes it very easy to zoom through all profiles and find the ones you regularly use. Unfortunately starring is not available in the account view, just the profile view.</p> <p><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/favs.jpg" alt="" title="Viewing your favorite profiles in Google Analytics" width="500" height="279" class="aligncenter size-full wp-image-868" /></p> <p>Try changing the number of rows displayed using the drop down at the bottom of the table&#8230; Notice anything interesting? The new interface uses AJAX to dynamically pull back the data. Pretty slick.</p> <p>Another interesting AJAX feature is the ability to rename accounts and profiles right from the table. Just click on the little pen icon next to an account name or profile name. Is this totally necessary? I&#8217;ll let you decide. But given the new interface I bet a lot of people are going to rename their accounts and profiles.</p> <p><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/picture-12.png" alt="" title="Changing the name of an account or profile from GA admin interface" width="330" height="90" class="aligncenter size-full wp-image-835" /></p> <p>With the new layout of accounts and profiles we can eliminate the website domain name from the profile and account name and use a functional description that everyone can understand.</p> <p>One thing that is missing from the new admin screen is a summary row. I think it&#8217;s critical to have a scorecard, similar to the scorecard in the reporting interface, that displays summary information for the profiles and accounts displayed. </p> <p>Overall, this is a fantastic change that goes a long way to helping us manage and analyze large GA deployments.</p> <div class="feedflare"> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=lCj9m"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=lCj9m" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=EQcQm"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=EQcQm" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=gKegm"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=gKegm" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=Sj8tm"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=Sj8tm" border="0"></img></a> </div><img src="http://feeds.feedburner.com/~r/AnalyticsTalk/~4/428829783" height="1" width="1"/>" } ["wfw"]=> array(1) { ["commentrss"]=> string(101) "http://www.epikone.com/blog/2008/10/22/getting-to-know-the-new-google-analytics-admin-interface/feed/" } ["feedburner"]=> array(2) { ["awareness"]=> string(192) "http://api.feedburner.com/awareness/1.0/GetItemData?uri=AnalyticsTalk&itemurl=http%3A%2F%2Fwww.epikone.com%2Fblog%2F2008%2F10%2F22%2Fgetting-to-know-the-new-google-analytics-admin-interface%2F" ["origlink"]=> string(96) "http://www.epikone.com/blog/2008/10/22/getting-to-know-the-new-google-analytics-admin-interface/" } ["summary"]=> string(286) " One part of Google Analytics that has seen very little love over the past few years is the administrative interface. Not any more! Google has rolled out a beta version of a new GA management tool that will have an immediate impact on how we set up and manage Google Analytics. [...]" ["atom_content"]=> string(5396) "<p> One part of Google Analytics that has seen very little love over the past few years is the administrative interface. Not any more! Google has rolled out a beta version of a new GA management tool that will have an immediate impact on how we set up and manage Google Analytics. </p> <p>When you firs log in the new admin area will display a list of all accounts that you have access to.</p> <p><a href="http://www.epikone.com/blog/wp-content/uploads/2008/10/admin-accounts.jpg"><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/admin-accounts-300x135.jpg" alt="" title="New Google Analytics Admin Interface" width="300" height="135" class="aligncenter size-medium wp-image-820" /></a><br /> Click to enlarge the image.</p> <p>This tabular layout of accounts is new, and very helpful. If you&#8217;re an agency, or a large company, you probably have access to multiple GA accounts. This layout makes it easy to identify performance at the account level.</p> <p>Key to the new layout is the addition of metrics. Available metrics in are:</p> <p>* Visits<br /> * Time on Site<br /> * Bounce Rate<br /> * Completed Goals</p> <p>One column actually does a date comparison. Choose one of the above metrics using the drop down at the top of the column and a simple date range using the buttons at the top right corner of the screen to determine how said metric has changed over the past day, week, month or year.</p> <p>Looking a bit closer, you&#8217;ll notice that each account name is a link. Clicking on the link will display all profiles within that account:</p> <p><a href="http://www.epikone.com/blog/wp-content/uploads/2008/10/new-admin-profile-view.jpg"><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/new-admin-profile-view-300x203.jpg" alt="" title="New GA Admin Interface - Profile View" width="300" height="203" class="aligncenter size-medium wp-image-825" /></a><br /> click to enlarge.</p> <p>This is where things get really juicy!</p> <p>GA is now grouping the profiles that have been created for each tracking code in an account. I&#8217;ve talked a lot about <a href="http://www.epikone.com/blog/2007/07/17/segmenting-visitor-loyalty-reports-in-ga/">creating multiple profiles for a single site</a>, and this is a great way to see all those properties in one place.</p> <p>As an analyst I like the fact that I can view basic information in the admin area and do a quick performance evaluation. Would I like to see more metrics? Sure, but this is a great start. This literally turns the admin area into a basic dashboard for large groups of websites.</p> <p>Another feature that I really like is the Favorites. Anyone that uses other Google products (like <a href="http://mail.google.com">GMail</a> or <a href="http://docs.google.com">GDocs</a>) will recognize this. </p> <p>You can &#8217;star&#8217; certain profiles and then display only those that you starred. This makes it very easy to zoom through all profiles and find the ones you regularly use. Unfortunately starring is not available in the account view, just the profile view.</p> <p><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/favs.jpg" alt="" title="Viewing your favorite profiles in Google Analytics" width="500" height="279" class="aligncenter size-full wp-image-868" /></p> <p>Try changing the number of rows displayed using the drop down at the bottom of the table&#8230; Notice anything interesting? The new interface uses AJAX to dynamically pull back the data. Pretty slick.</p> <p>Another interesting AJAX feature is the ability to rename accounts and profiles right from the table. Just click on the little pen icon next to an account name or profile name. Is this totally necessary? I&#8217;ll let you decide. But given the new interface I bet a lot of people are going to rename their accounts and profiles.</p> <p><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/picture-12.png" alt="" title="Changing the name of an account or profile from GA admin interface" width="330" height="90" class="aligncenter size-full wp-image-835" /></p> <p>With the new layout of accounts and profiles we can eliminate the website domain name from the profile and account name and use a functional description that everyone can understand.</p> <p>One thing that is missing from the new admin screen is a summary row. I think it&#8217;s critical to have a scorecard, similar to the scorecard in the reporting interface, that displays summary information for the profiles and accounts displayed. </p> <p>Overall, this is a fantastic change that goes a long way to helping us manage and analyze large GA deployments.</p> <div class="feedflare"> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=lCj9m"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=lCj9m" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=EQcQm"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=EQcQm" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=gKegm"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=gKegm" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=Sj8tm"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=Sj8tm" border="0"></img></a> </div><img src="http://feeds.feedburner.com/~r/AnalyticsTalk/~4/428829783" height="1" width="1"/>" } [5]=> array(13) { ["title"]=> string(38) "Google Analytics Advanced Segmentation" ["link"]=> string(58) "http://feeds.feedburner.com/~r/AnalyticsTalk/~3/428829786/" ["comments"]=> string(87) "http://www.epikone.com/blog/2008/10/22/google-analytics-advanced-segmentation/#comments" ["pubdate"]=> string(31) "Wed, 22 Oct 2008 18:34:03 +0000" ["dc"]=> array(1) { ["creator"]=> string(14) "Justin Cutroni" } ["category"]=> string(33) "analysisadvanced segmetnationv3.0" ["guid"]=> string(34) "http://www.epikone.com/blog/?p=847" ["description"]=> string(300) " Advanced segmentation is a new feature in Google Analytics that lets you segment all data in a profile. Why is this important? We now have an incredibly powerful segmentation tool that we can use to identify which segments of our traffic are performing and which are not. This leads to more [...]" ["content"]=> array(1) { ["encoded"]=> string(6918) "<p> Advanced segmentation is a new feature in Google Analytics that lets you segment all data in a profile. Why is this important? We now have an incredibly powerful segmentation tool that we can use to identify which segments of our traffic are performing and which are not. This leads to more analysis on the under performing segments and (hopefully) increased site performance.</p> <p>In the old days (i.e. last week) we needed to use filters and duplicate profiles to segment data. This approach worked, but it was a lot of work and had many pitfalls.</p> <p>Feel like segmenting by time on site? No problem. How about average order value? We can do that two. Remember my post about <a href="http://www.epikone.com/blog/2007/07/17/segmenting-visitor-loyalty-reports-in-ga/">segmenting time on site</a> in Google Analytics? This technique is now dead. Rest in peace.</p> <p>By the way, advanced segments are <strong>RETROACTIVE</strong>! This means that there is no need to reprocess historical data in Google Analytics. Well, there is no reason unless you mess up the implementation. You&#8217;re still out of luck if you do that. </p> <p>For those of you that don&#8217;t feel like reading, here&#8217;s a quick video tour of advanced segments.</p> <p><object width="425" height="350"><param name="movie" value="http://www.youtube.com/v/bGrvn_uqJeo"></param> <embed src="http://www.youtube.com/v/bGrvn_uqJeo" type="application/x-shockwave-flash" width="425" height="350"></embed></object></p> <p>Creating an advanced segment is pretty easy. Google added a cool interface where you drag and drop dimensions and metrics you want to use in your segment. </p> <p>Dimensions are the attributes of site visitors or the visits that they create. Think keyword, campaign, medium, new vs returning, etc. Metrics are basic counts of things that occur on the website. Think pageviews, visits, revenue, transactions, etc.</p> <p>The concept here is that you choose a dimension or metric that you want to segment by, specify a value for that dimension or metric, and then create a relationship between the two.</p> <p><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/picture-181.png" alt="" title="Use Dimensions and Metrics to create advanced segments" width="265" height="178" class="alignright size-full wp-image-855" /></p> <p>Let&#8217;s start with an example. Let&#8217;s create an advanced segment to view all visits that last at least 10 seconds. Why? Because those people are leaving aweful fast and I want to understand why.</p> <p>We start by choosing the Time on Site metric and dragging it to the correct location. HINT: If you don&#8217;t know whether you&#8217;re looking for a metric or dimension try the search! </p> <p>Once we place our metric we specify a condition that it must meet and a value. In this case we want the time on site metric to be &#8216;greater than&#8217; 10 seconds.</p> <p><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/picture-19.png" alt="" title="Creating an advanced segment in GA" width="493" height="300" class="aligncenter size-full wp-image-857" /></p> <p>I want to call your attention to the Value field. This is no simple text field. This is a dynamic field that updates with all potential values while you type. The interface is reaching back into the data to show you which values have been collected for the metric or dimension used in the segment. Pretty slick, huh?</p> <p>If we really wanted to get sophisticated we could add more dimensions and metrics to our advanced segment. Say we wanted to see all segments longer than 10 seconds from Google paid search. No problem, we can add &#8216;and&#8217; and &#8216;or&#8217; logic to link mulitple dimensions and metrics. Then we just keep dragging and dropping dimensions and metrics into the interface and adding values and conditions for each.</p> <p>Once we&#8217;ve created our segment we can apply it to a profile. Once applied all the data in the profile will be segmented. Again, this includes historical data as well!</p> <p>All Advanced Segments can be accessed via the Advanced Segment button in the top right corner of the screen. Click the button and you&#8217;ll see a nice big drop down with all your defined segments.</p> <p><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/picture-20.png" alt="" title="Finding your Advanced Segments in Google Analytics" width="500" height="211" class="aligncenter size-full wp-image-859" /></p> <p>Advanced Segment area grouped in two categories: default segments (created by google) and custom segments (created by you). Notice how you choose a segment using a check box? This means that you can display multiple segments at the same time.</p> <p>After you apply your segments the reporting interface will update and all reports will be segmented based on your criteria. We&#8217;ll see the results in a number of locations.</p> <p>First, notice that the data over time chart will update to include all of the segments that you chose. (Note that you can only display 4 segments in the data over time graph even if you choose more than 4 segments).</p> <p><a href="http://www.epikone.com/blog/wp-content/uploads/2008/10/picture-21.png"><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/picture-21-300x200.png" alt="" title="GA reporting with Advanced Segments" width="300" height="200" class="aligncenter size-medium wp-image-861" /></a><br /> Click to Enlarge.</p> <p>Now you can trend multiple segments of traffic on one graph. This is really great for visualizing how multiple campaigns, mediums or geographic segments perform over time. How cool is that!</p> <p>When you create an advanced segment it is tied to your specific user name. This means that you can use your advanced segment in all accounts and profiles that you have access to, which is pretty cool. Think of your advanced segments as a library that you can apply to different sets of data.</p> <p>I&#8217;ll be writing a lot more about Advanced Segments in the future, especially some really cool segments that help analysis. But this should be enough to get you going. :)</p> <div class="feedflare"> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=v5yqm"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=v5yqm" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=Cdncm"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=Cdncm" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=jvzKm"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=jvzKm" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=s3brm"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=s3brm" border="0"></img></a> </div><img src="http://feeds.feedburner.com/~r/AnalyticsTalk/~4/428829786" height="1" width="1"/>" } ["wfw"]=> array(1) { ["commentrss"]=> string(83) "http://www.epikone.com/blog/2008/10/22/google-analytics-advanced-segmentation/feed/" } ["feedburner"]=> array(2) { ["awareness"]=> string(174) "http://api.feedburner.com/awareness/1.0/GetItemData?uri=AnalyticsTalk&itemurl=http%3A%2F%2Fwww.epikone.com%2Fblog%2F2008%2F10%2F22%2Fgoogle-analytics-advanced-segmentation%2F" ["origlink"]=> string(78) "http://www.epikone.com/blog/2008/10/22/google-analytics-advanced-segmentation/" } ["summary"]=> string(300) " Advanced segmentation is a new feature in Google Analytics that lets you segment all data in a profile. Why is this important? We now have an incredibly powerful segmentation tool that we can use to identify which segments of our traffic are performing and which are not. This leads to more [...]" ["atom_content"]=> string(6918) "<p> Advanced segmentation is a new feature in Google Analytics that lets you segment all data in a profile. Why is this important? We now have an incredibly powerful segmentation tool that we can use to identify which segments of our traffic are performing and which are not. This leads to more analysis on the under performing segments and (hopefully) increased site performance.</p> <p>In the old days (i.e. last week) we needed to use filters and duplicate profiles to segment data. This approach worked, but it was a lot of work and had many pitfalls.</p> <p>Feel like segmenting by time on site? No problem. How about average order value? We can do that two. Remember my post about <a href="http://www.epikone.com/blog/2007/07/17/segmenting-visitor-loyalty-reports-in-ga/">segmenting time on site</a> in Google Analytics? This technique is now dead. Rest in peace.</p> <p>By the way, advanced segments are <strong>RETROACTIVE</strong>! This means that there is no need to reprocess historical data in Google Analytics. Well, there is no reason unless you mess up the implementation. You&#8217;re still out of luck if you do that. </p> <p>For those of you that don&#8217;t feel like reading, here&#8217;s a quick video tour of advanced segments.</p> <p><object width="425" height="350"><param name="movie" value="http://www.youtube.com/v/bGrvn_uqJeo"></param> <embed src="http://www.youtube.com/v/bGrvn_uqJeo" type="application/x-shockwave-flash" width="425" height="350"></embed></object></p> <p>Creating an advanced segment is pretty easy. Google added a cool interface where you drag and drop dimensions and metrics you want to use in your segment. </p> <p>Dimensions are the attributes of site visitors or the visits that they create. Think keyword, campaign, medium, new vs returning, etc. Metrics are basic counts of things that occur on the website. Think pageviews, visits, revenue, transactions, etc.</p> <p>The concept here is that you choose a dimension or metric that you want to segment by, specify a value for that dimension or metric, and then create a relationship between the two.</p> <p><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/picture-181.png" alt="" title="Use Dimensions and Metrics to create advanced segments" width="265" height="178" class="alignright size-full wp-image-855" /></p> <p>Let&#8217;s start with an example. Let&#8217;s create an advanced segment to view all visits that last at least 10 seconds. Why? Because those people are leaving aweful fast and I want to understand why.</p> <p>We start by choosing the Time on Site metric and dragging it to the correct location. HINT: If you don&#8217;t know whether you&#8217;re looking for a metric or dimension try the search! </p> <p>Once we place our metric we specify a condition that it must meet and a value. In this case we want the time on site metric to be &#8216;greater than&#8217; 10 seconds.</p> <p><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/picture-19.png" alt="" title="Creating an advanced segment in GA" width="493" height="300" class="aligncenter size-full wp-image-857" /></p> <p>I want to call your attention to the Value field. This is no simple text field. This is a dynamic field that updates with all potential values while you type. The interface is reaching back into the data to show you which values have been collected for the metric or dimension used in the segment. Pretty slick, huh?</p> <p>If we really wanted to get sophisticated we could add more dimensions and metrics to our advanced segment. Say we wanted to see all segments longer than 10 seconds from Google paid search. No problem, we can add &#8216;and&#8217; and &#8216;or&#8217; logic to link mulitple dimensions and metrics. Then we just keep dragging and dropping dimensions and metrics into the interface and adding values and conditions for each.</p> <p>Once we&#8217;ve created our segment we can apply it to a profile. Once applied all the data in the profile will be segmented. Again, this includes historical data as well!</p> <p>All Advanced Segments can be accessed via the Advanced Segment button in the top right corner of the screen. Click the button and you&#8217;ll see a nice big drop down with all your defined segments.</p> <p><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/picture-20.png" alt="" title="Finding your Advanced Segments in Google Analytics" width="500" height="211" class="aligncenter size-full wp-image-859" /></p> <p>Advanced Segment area grouped in two categories: default segments (created by google) and custom segments (created by you). Notice how you choose a segment using a check box? This means that you can display multiple segments at the same time.</p> <p>After you apply your segments the reporting interface will update and all reports will be segmented based on your criteria. We&#8217;ll see the results in a number of locations.</p> <p>First, notice that the data over time chart will update to include all of the segments that you chose. (Note that you can only display 4 segments in the data over time graph even if you choose more than 4 segments).</p> <p><a href="http://www.epikone.com/blog/wp-content/uploads/2008/10/picture-21.png"><img src="http://www.epikone.com/blog/wp-content/uploads/2008/10/picture-21-300x200.png" alt="" title="GA reporting with Advanced Segments" width="300" height="200" class="aligncenter size-medium wp-image-861" /></a><br /> Click to Enlarge.</p> <p>Now you can trend multiple segments of traffic on one graph. This is really great for visualizing how multiple campaigns, mediums or geographic segments perform over time. How cool is that!</p> <p>When you create an advanced segment it is tied to your specific user name. This means that you can use your advanced segment in all accounts and profiles that you have access to, which is pretty cool. Think of your advanced segments as a library that you can apply to different sets of data.</p> <p>I&#8217;ll be writing a lot more about Advanced Segments in the future, especially some really cool segments that help analysis. But this should be enough to get you going. :)</p> <div class="feedflare"> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=v5yqm"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=v5yqm" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=Cdncm"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=Cdncm" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=jvzKm"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=jvzKm" border="0"></img></a> <a href="http://feeds.feedburner.com/~f/AnalyticsTalk?a=s3brm"><img src="http://feeds.feedburner.com/~f/AnalyticsTalk?i=s3brm" border="0"></img></a> </div><img src="http://feeds.feedburner.com/~r/AnalyticsTalk/~4/428829786" height="1" width="1"/>" } [6]=> array(13) { ["title"]=> string(53) "Google Analytics Compliance with WAA Standard Metrics" ["link"]=> string(58) "http://feeds.feedburner.com/~r/AnalyticsTalk/~3/399454186/" ["comments"]=> string(102) "http://www.epikone.com/blog/2008/09/21/google-analytics-compliance-with-waa-standard-metrics/#comments" ["pubdate"]=> string(31) "Mon, 22 Sep 2008 04:16:19 +0000" ["dc"]=> array(1) { ["creator"]=> string(14) "Justin Cutroni" } ["category"]=> string(38) "about gaanalysisresourcesweb-analytics" ["guid"]=> string(34) "http://www.epikone.com/blog/?p=706" ["description"]=> string(343) " Following the lead of Dennis Mortensen (founder of IndexTools, Director of Insights at Yahoo!, WAA board member and all around good guy) I&#8217;ve decided to identify just how compliant GA is with these standards. Below is a list of all standards defined in the WAA metrics definitions document and GA compliance with each definition. [...]" ["content"]=> array(1) { ["encoded"]=> string(26092) "<p> <a href="http://visualrevenue.com/blog/2008/03/web-analytics-definitions-waa.html" target="_blank">Following the lead</a> of <a href="http://visualrevenue.com/" target="_blank">Dennis Mortensen</a> (founder of <a href="http://www.indextools.com/" target="_blank">IndexTools</a>, Director of Insights at <a href="http://www.yahoo.com" target="_blank">Yahoo!</a>, WAA board member and all around good guy) I&#8217;ve decided to identify just how compliant GA is with these standards.</p> <p>Below is a list of all standards defined in the <a href="http://www.webanalyticsassociation.org/attachments/committees/5/WAA-Standards-Analytics-Definitions-Volume-I-20070816.pdf" target="_blank">WAA metrics definitions</a> document and GA compliance with each definition. GA is compliant with 19 of the 26 metrics. Most of the non-compliance is due to the fact that GA does not offer all the metrics that the WAA defined.</p> <table class="" id="r503" border="1" bordercolor="#000000" cellpadding="3" cellspacing="0" width="100%"> <tbody> <tr bgcolor="#6fa8dc"> <td width="25%"> <b><font size="2">Compliant</font></b> </td> <td width="25%"> <b><font size="2">Term</font></b> </td> <td width="25%"> <b><font size="2">WAA Definition</font></b> </td> <td width="25%"> <b><font size="2">GA Definition</font></b> </td> </tr> <tr> <td width="25%"> <span style="color: rgb(56, 118, 29);"><b><font size="2">Yes</font></b></span> </td> <td width="25%"> <font size="2">Page</font> </td> <td width="25%"> <p style="margin: 0px;"> <font size="2">A page is an analyst definable unit of content.</font> </p> </td> <td width="25%"> <font size="2">Same as WAA<br /> </font></p> </td> </tr> <tr> <td width="25%"> <span style="color: rgb(56, 118, 29);"><b><font size="2">Yes</font></b></span> </td> <td width="25%"> <font size="2">Page View</font> </td> <td width="25%"> <p style="margin: 0px;"> <font size="2">The number of times a page (an analyst-definable unit of content) was viewed.</font> </p> </td> <td width="25%"> <font size="2">Same as WAA.</p> <p> Note: A pageview is created each time the _trackPageview() method is executed. Any value passed to the _trackPageview() method will appear in the Content reports, thus making a Page analyst definable.</font></td> </tr> <tr> <td width="25%"> <span style="color: rgb(56, 118, 29);"><b><font size="2">Yes</font></b></span> </td> <td width="25%"> <font size="2">Visits/Sessions</font> </td> <td width="25%"> <font size="2">A visit is an interaction, by an individual, with a website consisting of one or more requests for an analyst-definable unit of content (i.e. “page view”). If an individual has not taken another action (typically additional page views) on the site within a specified time period, the visit session will terminate.</font> </td> <td width="25%"> <font size="2">Same as WAA.</p> <p> Note: By default, a visit will terminate after 30 minutes of inactivity by the visitor. The legth of inactivity can be modified by altering the Google Analytics tracking code.</font></p> </td> </tr> <tr> <td width="25%"> <span style="color: rgb(56, 118, 29);"><b><font size="2">Yes</font></b></span> </td> <td width="25%"> <p style="margin: 0px;"> <font size="2">Unique Visitors</font></p> </td> <td width="25%"> <font size="2">The number of inferred individual people (filtered for spiders and robots), within a designated reporting timeframe, with activity consisting of one or more visits to a site. Each individual is counted only once in the unique visitor measure for the reporting period.</font> </td> <td width="25%"> <p style="margin: 0px;"> <font size="2">Same as WAA</font></p> <p style="margin: 0px; min-height: 14px;"> </p> <p style="margin: 0px;"> <font size="2">Note: Google Analytics defines this term as Absolute Unique Visitors.</font> </p> <p style="margin: 0px; min-height: 14px;"> </p> <p style="margin: 0px;"> <font size="2">A visitor is defined using a unique numeric identifier stored in the Google Analytics tracking cookies. This value is set when the visitor&#8217;s first visit is created.</font> </p> <p style="margin: 0px; min-height: 14px;"> </p> <p style="margin: 0px;"> <font size="2">Each visitor is counted only once in the Absolute Unique Visitor metric, regardless of how many times they return to the site during the reporting period.</font> </p> </td> </tr> <tr> <td width="25%"><span class="Apple-style-span" style="font-weight: bold; "><span class="Apple-style-span" style="color: rgb(56, 118, 29);">Yes</span></span></td> <td width="25%"> <p style="margin: 0px;"><font size="2">New Visitor</font> </p> </td> <td width="25%"> <p style="margin: 0px;"> <font size="2">The number of Unique Visitors with activity including a first-ever Visit to a site during a reporting period.</font></p> </td> <td width="25%"> <p style="margin: 0px;">Same as WAA</p> <p style="margin: 0px; min-height: 14px;"> </p> <p style="margin: 0px;"><font size="2">Note: While GA does share the same definition for a new visitor it does not does not count the number of new, unique people (visitors) that have visited the site during the reporting period. GA counts the number of VISITS generated by new people.</font></p> <p style="margin: 0px; min-height: 14px;"> </p> <p style="margin: 0px;"> <font size="2">Google Analytics calculate the number of New visitors by identifying the number of new unique visitor IDs that were created during the reporting period.</font> </p> <p style="margin: 0px; min-height: 14px;"> </p> <p style="margin: 0px;">It is possible to measure the number of new visitors using a profile and include filter.</p> </td> </tr> <tr> <td width="25%"> <span style="color: rgb(255, 0, 0);"><b><font size="2">NO</font></b></span></td> <td width="25%"> <p style="margin: 0px;"> <font size="2">Repeat Visitor</font></p> </td> <td width="25%"> <p style="margin: 0px;"> <font size="2">The number of Unique Visitors with activity consisting</font> </p> <p style="margin: 0px;"> <font size="2">of two or more Visits to a site during a reporting period.</font> </p> </td> <td width="25%"><font size="2"><br /> N/a</p> <p>This metric does not exist in Google Analytics.<br /> </font></td> </tr> <tr> <td width="25%"><span class="Apple-style-span" style="font-weight: bold; "><span class="Apple-style-span" style="color: rgb(56, 118, 29);">Yes</span></span></td> <td width="25%"> <p style="margin: 0px;"><font size="2">Return Visitor</font></p> </td> <td width="25%"> <font size="2">The number of Unique Visitors with activity consisting of a Visit to a site during a reporting period and where the Unique Visitor also Visited the site prior to the reporting period.</font></td> <td width="25%"> <p style="margin-top: 0px; margin-right: 0px; margin-bottom: 0px; margin-left: 0px; font-style: normal; font-variant: normal; font-weight: normal; line-height: normal">Same as WAA</p> <p style="margin: 0px; min-height: 14px;"> </p> <p style="margin-top: 0px; margin-right: 0px; margin-bottom: 0px; margin-left: 0px; font-style: normal; font-variant: normal; font-weight: normal; line-height: normal">Note: While GA does share the same definition for a return visitor it does not does not count the number of returning unique people (visitors) that have visited the site during the reporting period. GA counts the number of VISITS generated by people coming .</p> <p style="margin: 0px; min-height: 14px;"> </p> <p style="margin-top: 0px; margin-right: 0px; margin-bottom: 0px; margin-left: 0px; font-style: normal; font-variant: normal; font-weight: normal; line-height: normal">GA identifies a return visitor as any visit generated by a person who&#8217;s unique identifier cookie was set prior to the reporting period.</p> </p> </td> </tr> <tr> <td width="25%"> <span style="color: rgb(56, 118, 29);"><b><font size="2">Yes</font></b></span> </td> <td width="25%"> <p style="margin: 0px;"> <font size="2">Entry Page</font> </p> </td> <td width="25%"> <p style="margin: 0px;"> <font size="2">The first page of a visit.</font> </p> </td> <td width="25%"> <font size="2">Same as WAA</font> </td> </tr> <tr> <td width="25%"> <span style="color: rgb(56, 118, 29);"><b><font size="2">Yes</font></b></span> </td> <td width="25%"> <p style="margin: 0px;"> <font size="2">Landing Page</font> </p> <div> </div> </td> <td width="25%"> <p style="margin: 0px;"> <font size="2">A page intended to identify the beginning of the user</font> </p> <p style="margin: 0px;"> <font size="2">experience resulting from a defined marketing effort.</font> </p> </td> <td width="25%"> <p style="margin: 0px;"> <font size="2">Same as WAA</font> </p> </td> </tr> <tr> <td width="25%"> <span style="color: rgb(56, 118, 29);"><b><font size="2">Yes</font></b></span> </td> <td width="25%"> <p style="margin: 0px;"> <font size="2">Exit Page</font> </p> </td> <td width="25%"> <p style="margin: 0px;"> <font size="2">The last page on a site accessed during a visit, signifying the end of a visit/session.</font> </p> </td> <td width="25%"> <p style="margin: 0px;"> <font size="2">Same as WAA</font> </p> </td> </tr> <tr> <td width="25%"> <span style="color: rgb(56, 118, 29);"><b><font size="2">Yes</font></b></span> </td> <td width="25%"> <p style="margin: 0px;"> <font size="2">Visit Duration</font> </p> </td> <td width="25%"> <font size="2">The length of time in a session. Calculation is typically the timestamp of the last activity in the session minus the timestamp of the first activity of the session.</font> </td> <td width="25%"> <p style="margin: 0px;"> <font size="2">Same as WAA</font> </p> <p style="margin: 0px; min-height: 14px;"> </p> <p style="margin: 0px;"> <font size="2">Note: Google Analytics uses a different name for this metric. It is called &#8216;Average Time on Site&#8217;.</font> </p> <p style="margin: 0px; min-height: 14px;"> </p> <p style="margin: 0px;"> <font size="2">The average time on site is calculated by dividing the total time spent on the site by the total number of Visits. </font> </p> </td> </tr> <tr> <td width="25%"><span style="color: rgb(2